Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9TKT1

Protein Details
Accession A0A1L9TKT1   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-37ARAQISQAKKARNNRKQRTNKKSPKRNPWPPWKFVKHydrophilic
NLS Segment(s)
PositionSequence
10-30KKARNNRKQRTNKKSPKRNPW
Subcellular Location(s) mito 13, nucl 6, plas 4, cyto_nucl 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MARAQISQAKKARNNRKQRTNKKSPKRNPWPPWKFVKLILVIFGLLYLGIAIHILYSKAARATGSPH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.8
3 0.86
4 0.89
5 0.92
6 0.92
7 0.92
8 0.93
9 0.93
10 0.94
11 0.92
12 0.93
13 0.92
14 0.93
15 0.91
16 0.91
17 0.87
18 0.81
19 0.79
20 0.71
21 0.62
22 0.53
23 0.48
24 0.4
25 0.33
26 0.28
27 0.21
28 0.17
29 0.15
30 0.13
31 0.08
32 0.05
33 0.04
34 0.03
35 0.02
36 0.02
37 0.02
38 0.02
39 0.03
40 0.03
41 0.04
42 0.05
43 0.06
44 0.07
45 0.08
46 0.09
47 0.1