Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9TU93

Protein Details
Accession A0A1L9TU93   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
125-149QLPKTYAMRLFRKKVKKRGGQLVKPHydrophilic
NLS Segment(s)
PositionSequence
136-145RKKVKKRGGQ
Subcellular Location(s) mito 21, nucl 2.5, cyto_nucl 2.5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR018713  MPAB/Lcp_cat_dom  
Gene Ontology GO:0016491  F:oxidoreductase activity  
Pfam View protein in Pfam  
PF09995  MPAB_Lcp_cat  
Amino Acid Sequences MAERVFQAYSVMGTSLQVPRNMWPKNLKEFRMYWRDVIENQLRVTPDAELVLKEIFHPVKSVPLWARPAVVVAMPFIRRLTIEQLPPSLREQFNLKSTKSSRMLSGLFVSGMNCVYPFTPLFVRQLPKTYAMRLFRKKVKKRGGQLVKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.16
3 0.19
4 0.2
5 0.2
6 0.25
7 0.34
8 0.36
9 0.38
10 0.41
11 0.44
12 0.53
13 0.59
14 0.57
15 0.53
16 0.55
17 0.58
18 0.58
19 0.54
20 0.45
21 0.41
22 0.41
23 0.36
24 0.39
25 0.37
26 0.31
27 0.29
28 0.3
29 0.27
30 0.25
31 0.25
32 0.18
33 0.13
34 0.12
35 0.11
36 0.09
37 0.09
38 0.09
39 0.08
40 0.08
41 0.11
42 0.11
43 0.1
44 0.11
45 0.1
46 0.14
47 0.14
48 0.18
49 0.16
50 0.19
51 0.22
52 0.21
53 0.21
54 0.17
55 0.17
56 0.14
57 0.12
58 0.08
59 0.06
60 0.08
61 0.07
62 0.08
63 0.07
64 0.07
65 0.07
66 0.08
67 0.13
68 0.14
69 0.16
70 0.17
71 0.2
72 0.21
73 0.22
74 0.23
75 0.23
76 0.2
77 0.19
78 0.22
79 0.22
80 0.28
81 0.31
82 0.29
83 0.31
84 0.33
85 0.39
86 0.39
87 0.37
88 0.32
89 0.33
90 0.33
91 0.28
92 0.27
93 0.2
94 0.16
95 0.15
96 0.14
97 0.1
98 0.09
99 0.08
100 0.06
101 0.06
102 0.06
103 0.08
104 0.08
105 0.1
106 0.13
107 0.14
108 0.18
109 0.23
110 0.27
111 0.27
112 0.33
113 0.32
114 0.36
115 0.37
116 0.38
117 0.41
118 0.44
119 0.52
120 0.56
121 0.62
122 0.66
123 0.74
124 0.79
125 0.82
126 0.85
127 0.85
128 0.85
129 0.88