Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9T8P4

Protein Details
Accession A0A1L9T8P4    Localization Confidence High Confidence Score 18.5
NoLS Segment(s)
PositionSequenceProtein Nature
128-155ESPHMKRVRAQRDSPRRGRRRSPSYSSYHydrophilic
NLS Segment(s)
PositionSequence
49-98PPPVLSARGKHGRQRHLPGRHADNRSPRHSPYRQRASSPRAHGRARPMEG
103-112RPRSLSRSRS
129-149SPHMKRVRAQRDSPRRGRRRS
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MANRGTAYILYHDPADAEAAIAHMHEAQFDGAVLNVSIVLPKKAFSRSPPPVLSARGKHGRQRHLPGRHADNRSPRHSPYRQRASSPRAHGRARPMEGHDLYRPRSLSRSRSRSPQDARSFSTRSPSESPHMKRVRAQRDSPRRGRRRSPSYSSYDYSSRSRSRAHSRDRGRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.1
4 0.08
5 0.07
6 0.07
7 0.07
8 0.06
9 0.06
10 0.06
11 0.06
12 0.06
13 0.07
14 0.07
15 0.07
16 0.07
17 0.06
18 0.05
19 0.06
20 0.06
21 0.05
22 0.04
23 0.04
24 0.06
25 0.07
26 0.08
27 0.08
28 0.09
29 0.12
30 0.16
31 0.19
32 0.22
33 0.32
34 0.37
35 0.44
36 0.44
37 0.45
38 0.43
39 0.46
40 0.46
41 0.39
42 0.4
43 0.42
44 0.43
45 0.46
46 0.51
47 0.55
48 0.56
49 0.62
50 0.64
51 0.63
52 0.66
53 0.65
54 0.66
55 0.66
56 0.63
57 0.59
58 0.59
59 0.57
60 0.57
61 0.55
62 0.48
63 0.49
64 0.51
65 0.55
66 0.56
67 0.6
68 0.57
69 0.58
70 0.62
71 0.59
72 0.59
73 0.58
74 0.55
75 0.5
76 0.5
77 0.48
78 0.49
79 0.49
80 0.44
81 0.39
82 0.34
83 0.35
84 0.34
85 0.34
86 0.31
87 0.28
88 0.28
89 0.29
90 0.27
91 0.22
92 0.27
93 0.29
94 0.34
95 0.41
96 0.47
97 0.47
98 0.55
99 0.6
100 0.64
101 0.65
102 0.65
103 0.64
104 0.59
105 0.61
106 0.58
107 0.55
108 0.46
109 0.49
110 0.39
111 0.36
112 0.35
113 0.35
114 0.35
115 0.41
116 0.45
117 0.48
118 0.52
119 0.49
120 0.52
121 0.59
122 0.63
123 0.61
124 0.65
125 0.66
126 0.72
127 0.79
128 0.83
129 0.85
130 0.84
131 0.85
132 0.87
133 0.86
134 0.85
135 0.84
136 0.82
137 0.78
138 0.77
139 0.75
140 0.67
141 0.61
142 0.55
143 0.5
144 0.46
145 0.46
146 0.43
147 0.4
148 0.43
149 0.46
150 0.54
151 0.6
152 0.65
153 0.68