Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9SXR1

Protein Details
Accession A0A1L9SXR1   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
63-95SLCYYEPNKDKRRKEALKKCATNKKSSNKSHHYHydrophilic
NLS Segment(s)
PositionSequence
73-81KRRKEALKK
Subcellular Location(s) nucl 14.5, mito 11, cyto_nucl 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS50048  ZN2_CY6_FUNGAL_2  
Amino Acid Sequences MAHRETKISFRPLLPATKFNPANDQQASHQKRKRQTIACAPCQIKRTKCSGSSPCVSCTETGSLCYYEPNKDKRRKEALKKCATNKKSSNKSHHYTVPRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.42
3 0.4
4 0.46
5 0.47
6 0.42
7 0.46
8 0.41
9 0.44
10 0.39
11 0.38
12 0.33
13 0.42
14 0.47
15 0.48
16 0.5
17 0.5
18 0.57
19 0.64
20 0.68
21 0.64
22 0.66
23 0.67
24 0.71
25 0.7
26 0.7
27 0.62
28 0.57
29 0.55
30 0.53
31 0.46
32 0.41
33 0.41
34 0.37
35 0.38
36 0.42
37 0.42
38 0.41
39 0.43
40 0.41
41 0.37
42 0.36
43 0.34
44 0.26
45 0.24
46 0.21
47 0.16
48 0.16
49 0.15
50 0.13
51 0.13
52 0.16
53 0.15
54 0.19
55 0.25
56 0.33
57 0.41
58 0.49
59 0.55
60 0.61
61 0.71
62 0.75
63 0.8
64 0.82
65 0.83
66 0.85
67 0.87
68 0.88
69 0.87
70 0.82
71 0.8
72 0.79
73 0.79
74 0.78
75 0.8
76 0.8
77 0.79
78 0.8
79 0.77
80 0.77