Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9TZM1

Protein Details
Accession A0A1L9TZM1    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
51-71PLDCRLRKTGKEKRSRREGLVBasic
NLS Segment(s)
PositionSequence
58-66KTGKEKRSR
Subcellular Location(s) extr 15, plas 4, golg 3, E.R. 2, nucl 1, mito 1, pero 1, mito_nucl 1
Family & Domain DBs
Amino Acid Sequences MDRIRSESVVLVRLPLSLLISGALTGSITWSLQELGYWRRTAQKEDQRPSPLDCRLRKTGKEKRSRREGLVGRVETCT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.12
3 0.11
4 0.08
5 0.08
6 0.07
7 0.06
8 0.06
9 0.06
10 0.05
11 0.04
12 0.04
13 0.04
14 0.04
15 0.04
16 0.04
17 0.05
18 0.05
19 0.05
20 0.05
21 0.07
22 0.1
23 0.12
24 0.13
25 0.13
26 0.19
27 0.2
28 0.25
29 0.32
30 0.39
31 0.46
32 0.5
33 0.56
34 0.53
35 0.54
36 0.54
37 0.5
38 0.48
39 0.47
40 0.47
41 0.47
42 0.52
43 0.56
44 0.59
45 0.63
46 0.66
47 0.67
48 0.74
49 0.77
50 0.78
51 0.82
52 0.82
53 0.77
54 0.77
55 0.74
56 0.73
57 0.74
58 0.67