Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9TZ27

Protein Details
Accession A0A1L9TZ27    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
57-80EDSICPKTRARRKRIAEPMRPTFAHydrophilic
NLS Segment(s)
PositionSequence
67-69RRK
Subcellular Location(s) mito 14, nucl 5.5, cyto_nucl 5, cyto 3.5, plas 2, pero 2
Family & Domain DBs
Amino Acid Sequences MAWVYFIFGISGSGVCFTVRHLFCLVECCTFPRVLRYFIGVKKRKAGKESTVRTLSEDSICPKTRARRKRIAEPMRPTFATGRSTNDPYHKRREV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.09
5 0.17
6 0.17
7 0.19
8 0.2
9 0.2
10 0.2
11 0.25
12 0.25
13 0.18
14 0.18
15 0.18
16 0.18
17 0.19
18 0.19
19 0.21
20 0.22
21 0.22
22 0.22
23 0.24
24 0.27
25 0.31
26 0.41
27 0.39
28 0.39
29 0.44
30 0.5
31 0.49
32 0.47
33 0.47
34 0.45
35 0.49
36 0.52
37 0.51
38 0.47
39 0.44
40 0.42
41 0.4
42 0.33
43 0.24
44 0.21
45 0.18
46 0.22
47 0.23
48 0.23
49 0.26
50 0.34
51 0.42
52 0.51
53 0.56
54 0.6
55 0.65
56 0.74
57 0.81
58 0.82
59 0.82
60 0.81
61 0.8
62 0.76
63 0.69
64 0.61
65 0.52
66 0.46
67 0.42
68 0.34
69 0.34
70 0.34
71 0.37
72 0.39
73 0.46
74 0.51
75 0.52