Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C0NS15

Protein Details
Accession C0NS15   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
80-107VLSHGRPASQRRRNRPQRPARNCHSRTGHydrophilic
NLS Segment(s)
PositionSequence
64-122LLPRWKAPEPLRQRGTVLSHGRPASQRRRNRPQRPARNCHSRTGRGRGRGARARSRLAR
Subcellular Location(s) mito 13, nucl 12, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MKHTKWTTCPQQGGKARSHSHSHRLISCLALPYTGRKVSFQSAAVSTPCSPFHRASIATPKRGLLPRWKAPEPLRQRGTVLSHGRPASQRRRNRPQRPARNCHSRTGRGRGRGARARSRLARAVGSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.64
3 0.59
4 0.56
5 0.59
6 0.54
7 0.54
8 0.57
9 0.56
10 0.5
11 0.49
12 0.45
13 0.4
14 0.36
15 0.32
16 0.24
17 0.2
18 0.17
19 0.19
20 0.23
21 0.23
22 0.21
23 0.19
24 0.22
25 0.24
26 0.27
27 0.24
28 0.21
29 0.2
30 0.21
31 0.2
32 0.19
33 0.16
34 0.16
35 0.17
36 0.17
37 0.19
38 0.18
39 0.19
40 0.2
41 0.21
42 0.22
43 0.31
44 0.32
45 0.31
46 0.31
47 0.3
48 0.31
49 0.32
50 0.32
51 0.3
52 0.34
53 0.38
54 0.44
55 0.45
56 0.45
57 0.46
58 0.54
59 0.52
60 0.54
61 0.49
62 0.44
63 0.44
64 0.42
65 0.42
66 0.4
67 0.37
68 0.3
69 0.32
70 0.32
71 0.33
72 0.34
73 0.38
74 0.41
75 0.46
76 0.53
77 0.58
78 0.69
79 0.78
80 0.84
81 0.88
82 0.88
83 0.9
84 0.91
85 0.9
86 0.88
87 0.88
88 0.81
89 0.79
90 0.77
91 0.75
92 0.72
93 0.73
94 0.72
95 0.68
96 0.74
97 0.71
98 0.72
99 0.71
100 0.72
101 0.71
102 0.69
103 0.7
104 0.68
105 0.68
106 0.64
107 0.59