Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9T578

Protein Details
Accession A0A1L9T578   
Localization Confidence Medium
Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
19-43AEPPTPSKKAKKGPRGKFPKPGCNGBasic
51-71VPVCRVCKRRHNGPCNLRKRGHydrophilic
NLS Segment(s)
PositionSequence
24-38PSKKAKKGPRGKFPK
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 4
Family & Domain DBs
Amino Acid Sequences MFSQAYCGRGDVPATASAAEPPTPSKKAKKGPRGKFPKPGCNGLAHEGVCVPVCRVCKRRHNGPCNLRKRGWSWSWCGRPMETSDSTLKVQFHSQRRLSNGVSELVLLTQPKPSHRLYRGKAYSLPRLTGTFGENGKPGYQAITSGDVFTITTPDSRSLPLPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.14
4 0.15
5 0.16
6 0.15
7 0.13
8 0.16
9 0.21
10 0.24
11 0.29
12 0.36
13 0.43
14 0.53
15 0.62
16 0.69
17 0.74
18 0.8
19 0.85
20 0.87
21 0.85
22 0.86
23 0.83
24 0.82
25 0.76
26 0.73
27 0.63
28 0.58
29 0.54
30 0.47
31 0.44
32 0.34
33 0.29
34 0.23
35 0.21
36 0.17
37 0.14
38 0.11
39 0.1
40 0.13
41 0.18
42 0.24
43 0.31
44 0.4
45 0.46
46 0.56
47 0.64
48 0.69
49 0.74
50 0.78
51 0.81
52 0.8
53 0.8
54 0.71
55 0.63
56 0.58
57 0.55
58 0.51
59 0.44
60 0.41
61 0.44
62 0.47
63 0.47
64 0.45
65 0.38
66 0.33
67 0.32
68 0.31
69 0.23
70 0.22
71 0.2
72 0.21
73 0.21
74 0.22
75 0.19
76 0.15
77 0.19
78 0.23
79 0.28
80 0.34
81 0.37
82 0.39
83 0.42
84 0.45
85 0.41
86 0.37
87 0.32
88 0.25
89 0.22
90 0.18
91 0.15
92 0.11
93 0.11
94 0.08
95 0.07
96 0.1
97 0.11
98 0.13
99 0.17
100 0.2
101 0.28
102 0.35
103 0.44
104 0.45
105 0.54
106 0.56
107 0.56
108 0.59
109 0.56
110 0.58
111 0.51
112 0.48
113 0.39
114 0.37
115 0.35
116 0.3
117 0.27
118 0.22
119 0.2
120 0.2
121 0.2
122 0.2
123 0.19
124 0.18
125 0.16
126 0.14
127 0.13
128 0.12
129 0.13
130 0.17
131 0.16
132 0.16
133 0.16
134 0.14
135 0.14
136 0.13
137 0.12
138 0.08
139 0.1
140 0.11
141 0.14
142 0.15
143 0.17