Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9TI85

Protein Details
Accession A0A1L9TI85   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
12-41LLWKIPWRISQPQKARQRKRLRSVDRVVDTHydrophilic
78-99FDKKEKTYRKGIHKLPKWTRVSBasic
NLS Segment(s)
Subcellular Location(s) mito 22, mito_nucl 13.833, cyto_mito 11.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFKPSSPLFSGLLWKIPWRISQPQKARQRKRLRSVDRVVDTLSTALRRNGETTKAIERWYKEMPREEEMLPRDKYTLFDKKEKTYRKGIHKLPKWTRVSQRVNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.26
4 0.28
5 0.28
6 0.37
7 0.42
8 0.51
9 0.58
10 0.65
11 0.73
12 0.8
13 0.84
14 0.85
15 0.87
16 0.87
17 0.88
18 0.89
19 0.87
20 0.85
21 0.83
22 0.81
23 0.72
24 0.63
25 0.53
26 0.43
27 0.35
28 0.26
29 0.2
30 0.12
31 0.11
32 0.11
33 0.11
34 0.11
35 0.13
36 0.14
37 0.16
38 0.16
39 0.18
40 0.21
41 0.21
42 0.22
43 0.22
44 0.22
45 0.24
46 0.28
47 0.29
48 0.28
49 0.34
50 0.36
51 0.36
52 0.38
53 0.34
54 0.34
55 0.34
56 0.36
57 0.31
58 0.28
59 0.26
60 0.23
61 0.25
62 0.26
63 0.32
64 0.31
65 0.38
66 0.41
67 0.49
68 0.57
69 0.63
70 0.61
71 0.63
72 0.66
73 0.69
74 0.74
75 0.76
76 0.77
77 0.77
78 0.83
79 0.82
80 0.84
81 0.79
82 0.78
83 0.79
84 0.79
85 0.8
86 0.77
87 0.79