Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9TB55

Protein Details
Accession A0A1L9TB55    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
168-189RGTTPGRKLRRHRISNQLRSGGHydrophilic
NLS Segment(s)
PositionSequence
150-154RKGIK
159-162RLRK
172-178PGRKLRR
Subcellular Location(s) nucl 11, mito_nucl 10.999, cyto_nucl 9.833, mito 9.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MLCPCAKSYFMVEGLQTERPRLVRSKFQQLPSSHSRAPLPMQVRPQSAKEHHQRREYEQDQEAKACSYGPGKAPAILITPIPEEPESAHTEDKDHLSRKILRSNTDDRAKDVRVEVGRTSSRSPTPEAPASDVMKIRVYKRDGNATQIRRKGIKSEEIRLRKGDVVVRGTTPGRKLRRHRISNQLRSGGTTQIRNGSRVPFGTVVLDWVGEKSIAGYMSCGAIPC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.31
3 0.27
4 0.24
5 0.25
6 0.25
7 0.29
8 0.33
9 0.35
10 0.39
11 0.45
12 0.54
13 0.57
14 0.62
15 0.66
16 0.61
17 0.64
18 0.61
19 0.62
20 0.53
21 0.49
22 0.44
23 0.39
24 0.4
25 0.39
26 0.35
27 0.33
28 0.39
29 0.41
30 0.44
31 0.44
32 0.43
33 0.44
34 0.45
35 0.49
36 0.52
37 0.57
38 0.6
39 0.65
40 0.66
41 0.64
42 0.71
43 0.64
44 0.6
45 0.56
46 0.54
47 0.48
48 0.46
49 0.39
50 0.3
51 0.27
52 0.2
53 0.16
54 0.12
55 0.13
56 0.14
57 0.18
58 0.18
59 0.19
60 0.19
61 0.18
62 0.18
63 0.16
64 0.14
65 0.1
66 0.11
67 0.1
68 0.11
69 0.1
70 0.09
71 0.09
72 0.12
73 0.14
74 0.15
75 0.16
76 0.14
77 0.15
78 0.17
79 0.19
80 0.2
81 0.19
82 0.19
83 0.22
84 0.28
85 0.3
86 0.35
87 0.34
88 0.34
89 0.38
90 0.42
91 0.45
92 0.47
93 0.44
94 0.4
95 0.41
96 0.38
97 0.33
98 0.28
99 0.26
100 0.2
101 0.21
102 0.18
103 0.18
104 0.18
105 0.19
106 0.2
107 0.18
108 0.19
109 0.19
110 0.22
111 0.21
112 0.25
113 0.26
114 0.26
115 0.26
116 0.27
117 0.27
118 0.26
119 0.23
120 0.2
121 0.2
122 0.21
123 0.2
124 0.23
125 0.26
126 0.29
127 0.31
128 0.39
129 0.36
130 0.42
131 0.49
132 0.49
133 0.52
134 0.51
135 0.52
136 0.45
137 0.45
138 0.43
139 0.39
140 0.42
141 0.39
142 0.44
143 0.51
144 0.54
145 0.55
146 0.51
147 0.49
148 0.42
149 0.4
150 0.35
151 0.3
152 0.29
153 0.27
154 0.27
155 0.27
156 0.27
157 0.27
158 0.28
159 0.31
160 0.35
161 0.42
162 0.5
163 0.59
164 0.68
165 0.74
166 0.76
167 0.79
168 0.83
169 0.84
170 0.83
171 0.78
172 0.67
173 0.62
174 0.56
175 0.52
176 0.45
177 0.37
178 0.32
179 0.34
180 0.36
181 0.34
182 0.34
183 0.31
184 0.31
185 0.29
186 0.31
187 0.24
188 0.23
189 0.23
190 0.21
191 0.19
192 0.16
193 0.15
194 0.11
195 0.11
196 0.11
197 0.08
198 0.08
199 0.07
200 0.09
201 0.1
202 0.09
203 0.1
204 0.1
205 0.11