Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9TVU7

Protein Details
Accession A0A1L9TVU7    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
13-38RPATACTECQRRKQKCNRSWPCNHCQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 10, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS50048  ZN2_CY6_FUNGAL_2  
Amino Acid Sequences MAAHDGSKKAPVRPATACTECQRRKQKCNRSWPCNHCQARKIAHQCKFAPKKTVRAANSVANDKRTPEAHQI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.43
3 0.43
4 0.44
5 0.43
6 0.5
7 0.49
8 0.55
9 0.61
10 0.61
11 0.68
12 0.75
13 0.8
14 0.78
15 0.85
16 0.86
17 0.84
18 0.87
19 0.84
20 0.79
21 0.78
22 0.75
23 0.67
24 0.6
25 0.57
26 0.51
27 0.53
28 0.56
29 0.54
30 0.56
31 0.59
32 0.58
33 0.63
34 0.67
35 0.62
36 0.62
37 0.57
38 0.59
39 0.61
40 0.67
41 0.58
42 0.56
43 0.56
44 0.53
45 0.55
46 0.54
47 0.49
48 0.45
49 0.44
50 0.4
51 0.41
52 0.36