Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9T6H8

Protein Details
Accession A0A1L9T6H8   
Localization Confidence Low
Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
68-87DIIGKWFKRHPERRKDIFLAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 10.5, mito 9, cyto_nucl 8.5, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR020471  AKR  
IPR023210  NADP_OxRdtase_dom  
IPR036812  NADP_OxRdtase_dom_sf  
Gene Ontology GO:0016491  F:oxidoreductase activity  
Pfam View protein in Pfam  
PF00248  Aldo_ket_red  
Amino Acid Sequences MSRPVSSLKRQLGRDGLKIPAIGLGLMGMSIGYGPAASDGERLQLLDYAWTIGCTNWDTADIYGDNEDIIGKWFKRHPERRKDIFLATKFGLKASSEGISIDSSPEYCKSCIERSLQRLGVDYIDLYYVHRPNASVPIERTIDVMKGFVEEGKVKYLGLSEISSSTLRRAQAIHPISAAQVEYNPWTLDIEGPSGTYLLETCRELGVAIFAYAPLGRGIMTGRYRSSTDFGPDDARSGMTRFQGENFAQNLNLVDKFKELAERKCCTPGQMVLSWLLAQGDNIFVIPGTKKVAYLEENFNSTSVVLTQDEELRLRELVTKAGVSGDRGPTFGAYVDTVPLVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.55
3 0.49
4 0.44
5 0.42
6 0.36
7 0.28
8 0.23
9 0.16
10 0.13
11 0.09
12 0.07
13 0.06
14 0.06
15 0.03
16 0.03
17 0.03
18 0.03
19 0.02
20 0.02
21 0.03
22 0.04
23 0.05
24 0.05
25 0.07
26 0.08
27 0.1
28 0.1
29 0.11
30 0.1
31 0.11
32 0.11
33 0.11
34 0.11
35 0.11
36 0.11
37 0.11
38 0.11
39 0.09
40 0.11
41 0.12
42 0.12
43 0.11
44 0.12
45 0.13
46 0.12
47 0.15
48 0.13
49 0.13
50 0.13
51 0.12
52 0.1
53 0.09
54 0.09
55 0.06
56 0.09
57 0.12
58 0.12
59 0.16
60 0.2
61 0.29
62 0.4
63 0.5
64 0.58
65 0.65
66 0.75
67 0.78
68 0.83
69 0.78
70 0.75
71 0.73
72 0.65
73 0.59
74 0.5
75 0.46
76 0.38
77 0.34
78 0.28
79 0.19
80 0.18
81 0.15
82 0.15
83 0.11
84 0.11
85 0.12
86 0.11
87 0.11
88 0.1
89 0.09
90 0.08
91 0.09
92 0.11
93 0.12
94 0.12
95 0.15
96 0.18
97 0.2
98 0.24
99 0.29
100 0.33
101 0.36
102 0.42
103 0.42
104 0.39
105 0.38
106 0.34
107 0.29
108 0.22
109 0.17
110 0.1
111 0.08
112 0.08
113 0.07
114 0.11
115 0.12
116 0.12
117 0.12
118 0.12
119 0.13
120 0.2
121 0.21
122 0.2
123 0.2
124 0.24
125 0.24
126 0.24
127 0.24
128 0.17
129 0.16
130 0.13
131 0.13
132 0.08
133 0.08
134 0.07
135 0.07
136 0.08
137 0.08
138 0.09
139 0.11
140 0.11
141 0.1
142 0.1
143 0.1
144 0.09
145 0.09
146 0.08
147 0.07
148 0.07
149 0.09
150 0.09
151 0.09
152 0.1
153 0.11
154 0.11
155 0.12
156 0.13
157 0.13
158 0.21
159 0.23
160 0.22
161 0.19
162 0.19
163 0.18
164 0.17
165 0.16
166 0.07
167 0.05
168 0.06
169 0.06
170 0.07
171 0.07
172 0.06
173 0.07
174 0.07
175 0.08
176 0.08
177 0.08
178 0.07
179 0.07
180 0.07
181 0.07
182 0.06
183 0.05
184 0.05
185 0.05
186 0.06
187 0.06
188 0.07
189 0.07
190 0.07
191 0.07
192 0.07
193 0.07
194 0.06
195 0.05
196 0.05
197 0.05
198 0.05
199 0.05
200 0.05
201 0.04
202 0.04
203 0.04
204 0.04
205 0.05
206 0.1
207 0.13
208 0.14
209 0.15
210 0.17
211 0.18
212 0.19
213 0.21
214 0.17
215 0.19
216 0.18
217 0.19
218 0.2
219 0.19
220 0.19
221 0.17
222 0.16
223 0.14
224 0.14
225 0.15
226 0.14
227 0.16
228 0.15
229 0.16
230 0.21
231 0.21
232 0.24
233 0.23
234 0.22
235 0.19
236 0.19
237 0.19
238 0.15
239 0.17
240 0.13
241 0.12
242 0.12
243 0.13
244 0.13
245 0.2
246 0.23
247 0.29
248 0.36
249 0.39
250 0.4
251 0.46
252 0.46
253 0.4
254 0.4
255 0.36
256 0.34
257 0.32
258 0.31
259 0.26
260 0.27
261 0.24
262 0.2
263 0.16
264 0.1
265 0.09
266 0.08
267 0.07
268 0.06
269 0.06
270 0.06
271 0.05
272 0.07
273 0.07
274 0.09
275 0.12
276 0.12
277 0.13
278 0.15
279 0.19
280 0.22
281 0.26
282 0.32
283 0.31
284 0.33
285 0.33
286 0.31
287 0.27
288 0.23
289 0.19
290 0.11
291 0.12
292 0.1
293 0.11
294 0.13
295 0.15
296 0.17
297 0.18
298 0.19
299 0.18
300 0.17
301 0.17
302 0.21
303 0.19
304 0.2
305 0.21
306 0.2
307 0.18
308 0.22
309 0.22
310 0.2
311 0.24
312 0.28
313 0.27
314 0.27
315 0.27
316 0.24
317 0.24
318 0.21
319 0.17
320 0.12
321 0.12
322 0.13