Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9TL00

Protein Details
Accession A0A1L9TL00   
Localization Confidence High
Confidence Score 17.6
NoLS Segment(s)
PositionSequenceProtein Nature
8-33GSDQARGRKKTKGKRMFDRCWQWNRTHydrophilic
77-102REGPTTPEKRLSRRRRESDRVVEQEKBasic
NLS Segment(s)
PositionSequence
12-22ARGRKKTKGKR
84-91EKRLSRRR
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 4
Family & Domain DBs
Amino Acid Sequences MQRKTKTGSDQARGRKKTKGKRMFDRCWQWNRTREVDKALAIDGEKQRYVVRAKQTGCNTYRENRDNRTIRPNLRGREGPTTPEKRLSRRRRESDRVVEQEKEVASGCQGSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.71
3 0.72
4 0.74
5 0.77
6 0.77
7 0.76
8 0.81
9 0.88
10 0.87
11 0.87
12 0.86
13 0.84
14 0.82
15 0.78
16 0.74
17 0.72
18 0.69
19 0.67
20 0.61
21 0.55
22 0.52
23 0.48
24 0.41
25 0.35
26 0.29
27 0.23
28 0.18
29 0.21
30 0.18
31 0.17
32 0.16
33 0.16
34 0.16
35 0.19
36 0.22
37 0.21
38 0.24
39 0.28
40 0.3
41 0.36
42 0.38
43 0.41
44 0.4
45 0.39
46 0.36
47 0.35
48 0.41
49 0.4
50 0.42
51 0.4
52 0.48
53 0.47
54 0.48
55 0.52
56 0.51
57 0.49
58 0.54
59 0.57
60 0.5
61 0.52
62 0.52
63 0.47
64 0.48
65 0.46
66 0.41
67 0.43
68 0.46
69 0.43
70 0.48
71 0.48
72 0.49
73 0.59
74 0.66
75 0.68
76 0.73
77 0.81
78 0.82
79 0.87
80 0.88
81 0.87
82 0.86
83 0.83
84 0.77
85 0.69
86 0.6
87 0.55
88 0.45
89 0.36
90 0.27
91 0.19
92 0.16