Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9T3S0

Protein Details
Accession A0A1L9T3S0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
35-59HRYPIIRRMARRNKKRDKSIFGICDHydrophilic
NLS Segment(s)
PositionSequence
42-50RMARRNKKR
Subcellular Location(s) cysk 17, cyto 8, cyto_nucl 6
Family & Domain DBs
Amino Acid Sequences MSDSERSGCGRLPMAWVILVGAIGDATEIHYCSGHRYPIIRRMARRNKKRDKSIFGICDEAVHGLSCDPC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.17
3 0.16
4 0.13
5 0.1
6 0.09
7 0.06
8 0.04
9 0.03
10 0.03
11 0.03
12 0.02
13 0.04
14 0.04
15 0.04
16 0.05
17 0.05
18 0.06
19 0.1
20 0.11
21 0.11
22 0.12
23 0.14
24 0.17
25 0.25
26 0.34
27 0.34
28 0.37
29 0.47
30 0.58
31 0.66
32 0.73
33 0.76
34 0.78
35 0.84
36 0.9
37 0.88
38 0.85
39 0.82
40 0.81
41 0.75
42 0.67
43 0.6
44 0.49
45 0.41
46 0.34
47 0.27
48 0.18
49 0.14
50 0.11