Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9TKE1

Protein Details
Accession A0A1L9TKE1   
Localization Confidence Low
Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
83-114KRLCEGCKPVRRKNRVYIICSKNPKHKQRQGKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 7.5, cyto_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
PROSITE View protein in PROSITE  
PS00828  RIBOSOMAL_L36  
Amino Acid Sequences MISLHSVVGPSTALLRQFLPRHSNLRALARPFSQLSQLTINNGLRLLRSGNGFTKSTEVGVGAVSAVKQLEQVRGMKTRSSVKRLCEGCKPVRRKNRVYIICSKNPKHKQRQGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.19
4 0.22
5 0.27
6 0.3
7 0.33
8 0.37
9 0.39
10 0.43
11 0.4
12 0.45
13 0.45
14 0.43
15 0.42
16 0.38
17 0.38
18 0.34
19 0.31
20 0.27
21 0.23
22 0.22
23 0.23
24 0.22
25 0.2
26 0.24
27 0.23
28 0.19
29 0.19
30 0.16
31 0.12
32 0.13
33 0.12
34 0.09
35 0.1
36 0.11
37 0.13
38 0.16
39 0.17
40 0.16
41 0.17
42 0.15
43 0.14
44 0.13
45 0.1
46 0.07
47 0.06
48 0.06
49 0.04
50 0.04
51 0.04
52 0.04
53 0.04
54 0.03
55 0.06
56 0.07
57 0.09
58 0.11
59 0.14
60 0.17
61 0.21
62 0.22
63 0.21
64 0.24
65 0.32
66 0.35
67 0.41
68 0.42
69 0.41
70 0.49
71 0.51
72 0.52
73 0.51
74 0.53
75 0.55
76 0.6
77 0.65
78 0.66
79 0.73
80 0.78
81 0.77
82 0.79
83 0.8
84 0.79
85 0.78
86 0.78
87 0.76
88 0.77
89 0.79
90 0.75
91 0.75
92 0.77
93 0.81
94 0.82