Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9T4T7

Protein Details
Accession A0A1L9T4T7   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
11-39QYRALFRERVRSRRRLRRRRAGARTGRASBasic
NLS Segment(s)
PositionSequence
18-36ERVRSRRRLRRRRAGARTG
Subcellular Location(s) mito 11, plas 9, extr 4, cyto 1, E.R. 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MIRPPIIWVIQYRALFRERVRSRRRLRRRRAGARTGRASLGLYGMQAGGCFSSLLSRFQPLVSVVVVVVYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.28
4 0.34
5 0.35
6 0.44
7 0.5
8 0.57
9 0.65
10 0.74
11 0.84
12 0.84
13 0.87
14 0.88
15 0.91
16 0.92
17 0.9
18 0.89
19 0.87
20 0.84
21 0.77
22 0.68
23 0.57
24 0.47
25 0.38
26 0.28
27 0.2
28 0.12
29 0.08
30 0.06
31 0.06
32 0.06
33 0.05
34 0.05
35 0.04
36 0.04
37 0.04
38 0.04
39 0.08
40 0.09
41 0.12
42 0.13
43 0.16
44 0.16
45 0.16
46 0.18
47 0.15
48 0.16
49 0.14
50 0.13
51 0.1