Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C0NHZ4

Protein Details
Accession C0NHZ4    Localization Confidence High Confidence Score 17.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-43MAKDKSDRERKKEKKEKKRSETDGVHKKSKKDKKKDTSLLAEABasic
234-258VLPRSSAKGKKDKDKKDKKDGGDGEBasic
NLS Segment(s)
PositionSequence
5-35KSDRERKKEKKEKKRSETDGVHKKSKKDKKK
239-252SAKGKKDKDKKDKK
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029064  L30e-like  
IPR004038  Ribosomal_L7Ae/L30e/S12e/Gad45  
IPR004037  Ribosomal_L7Ae_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF01248  Ribosomal_L7Ae  
PROSITE View protein in PROSITE  
PS01082  RIBOSOMAL_L7AE  
Amino Acid Sequences MAKDKSDRERKKEKKEKKRSETDGVHKKSKKDKKKDTSLLAEAVEKELTTKVLEHLEKPDAEPAPTVTAAETTSKKPAPERIVGALVPFANPLAQDKVAKKPLDPPTDVCRIQRDTAMTSIVRSNDVDGVRLPSNYFTNSNELSSSAAAVNKSLKRGVKEVVKALRKSPVPAPNAVIDTPTAVVVLAADISPMDVISHIPVLCEDHGIPYVYVTSRAELGSAGATKRPTSVVMVLPRSSAKGKKDKDKKDKKDGGDGEDKEYYTELVKVAQKESKRVKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.93
3 0.95
4 0.94
5 0.95
6 0.91
7 0.91
8 0.89
9 0.89
10 0.88
11 0.83
12 0.83
13 0.76
14 0.76
15 0.76
16 0.77
17 0.78
18 0.78
19 0.82
20 0.83
21 0.9
22 0.91
23 0.89
24 0.87
25 0.8
26 0.72
27 0.61
28 0.53
29 0.43
30 0.35
31 0.26
32 0.18
33 0.15
34 0.12
35 0.12
36 0.1
37 0.1
38 0.11
39 0.18
40 0.19
41 0.2
42 0.24
43 0.27
44 0.27
45 0.27
46 0.31
47 0.24
48 0.24
49 0.23
50 0.2
51 0.19
52 0.18
53 0.17
54 0.11
55 0.11
56 0.12
57 0.15
58 0.15
59 0.14
60 0.2
61 0.22
62 0.23
63 0.25
64 0.32
65 0.33
66 0.36
67 0.37
68 0.34
69 0.35
70 0.34
71 0.31
72 0.25
73 0.19
74 0.15
75 0.11
76 0.08
77 0.06
78 0.06
79 0.08
80 0.09
81 0.1
82 0.14
83 0.16
84 0.23
85 0.3
86 0.3
87 0.28
88 0.35
89 0.42
90 0.44
91 0.44
92 0.41
93 0.4
94 0.47
95 0.47
96 0.39
97 0.35
98 0.33
99 0.32
100 0.3
101 0.26
102 0.21
103 0.21
104 0.22
105 0.17
106 0.15
107 0.16
108 0.14
109 0.13
110 0.12
111 0.11
112 0.13
113 0.13
114 0.13
115 0.11
116 0.14
117 0.14
118 0.14
119 0.13
120 0.11
121 0.12
122 0.13
123 0.14
124 0.12
125 0.15
126 0.15
127 0.15
128 0.14
129 0.13
130 0.12
131 0.11
132 0.1
133 0.07
134 0.08
135 0.07
136 0.08
137 0.12
138 0.13
139 0.14
140 0.17
141 0.18
142 0.19
143 0.21
144 0.25
145 0.26
146 0.28
147 0.32
148 0.37
149 0.41
150 0.4
151 0.39
152 0.41
153 0.36
154 0.36
155 0.37
156 0.37
157 0.33
158 0.33
159 0.34
160 0.3
161 0.31
162 0.28
163 0.22
164 0.14
165 0.13
166 0.11
167 0.09
168 0.07
169 0.05
170 0.05
171 0.04
172 0.04
173 0.03
174 0.03
175 0.03
176 0.03
177 0.03
178 0.03
179 0.03
180 0.03
181 0.03
182 0.04
183 0.05
184 0.07
185 0.07
186 0.07
187 0.07
188 0.1
189 0.1
190 0.11
191 0.1
192 0.1
193 0.11
194 0.12
195 0.12
196 0.1
197 0.12
198 0.11
199 0.13
200 0.12
201 0.11
202 0.11
203 0.11
204 0.11
205 0.09
206 0.1
207 0.1
208 0.11
209 0.11
210 0.13
211 0.14
212 0.14
213 0.15
214 0.15
215 0.14
216 0.16
217 0.19
218 0.22
219 0.28
220 0.32
221 0.31
222 0.32
223 0.31
224 0.31
225 0.32
226 0.31
227 0.33
228 0.39
229 0.46
230 0.55
231 0.65
232 0.73
233 0.8
234 0.86
235 0.88
236 0.89
237 0.91
238 0.85
239 0.85
240 0.79
241 0.75
242 0.73
243 0.65
244 0.59
245 0.54
246 0.49
247 0.39
248 0.34
249 0.28
250 0.19
251 0.19
252 0.14
253 0.16
254 0.21
255 0.23
256 0.27
257 0.32
258 0.34
259 0.43