Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C0NG54

Protein Details
Accession C0NG54    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
32-55TVDLRHNGGRKKRKKSYLDFDLKEBasic
NLS Segment(s)
PositionSequence
39-46GGRKKRKK
Subcellular Location(s) nucl 13.5, cyto_nucl 12, cyto 9.5, mito 3
Family & Domain DBs
Amino Acid Sequences MPAAAWRLLEGGADVSDPIFRYLDPMNLTSATVDLRHNGGRKKRKKSYLDFDLKERGLKWKLDRKKLVTICCFKRFNSHDEAADAITGVANLFPGRICSKAPGILKGKVESVFVIQKVNGHVGEGGDVNLLREFSGYCKHSSGWSDGAMKENGREMGEMQEGKVEKRHKCGKTSYA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.08
4 0.09
5 0.1
6 0.09
7 0.09
8 0.12
9 0.13
10 0.17
11 0.18
12 0.18
13 0.19
14 0.19
15 0.2
16 0.17
17 0.16
18 0.12
19 0.11
20 0.11
21 0.1
22 0.13
23 0.17
24 0.21
25 0.28
26 0.37
27 0.46
28 0.55
29 0.64
30 0.71
31 0.77
32 0.81
33 0.84
34 0.84
35 0.84
36 0.84
37 0.76
38 0.71
39 0.67
40 0.59
41 0.51
42 0.41
43 0.37
44 0.31
45 0.33
46 0.36
47 0.4
48 0.47
49 0.55
50 0.61
51 0.59
52 0.65
53 0.66
54 0.66
55 0.64
56 0.64
57 0.61
58 0.62
59 0.59
60 0.49
61 0.53
62 0.48
63 0.44
64 0.42
65 0.38
66 0.31
67 0.3
68 0.3
69 0.21
70 0.18
71 0.14
72 0.07
73 0.05
74 0.04
75 0.04
76 0.03
77 0.03
78 0.03
79 0.03
80 0.03
81 0.05
82 0.06
83 0.07
84 0.08
85 0.09
86 0.11
87 0.16
88 0.17
89 0.22
90 0.25
91 0.28
92 0.29
93 0.28
94 0.29
95 0.24
96 0.24
97 0.18
98 0.17
99 0.16
100 0.14
101 0.14
102 0.12
103 0.13
104 0.14
105 0.16
106 0.13
107 0.11
108 0.11
109 0.1
110 0.11
111 0.09
112 0.08
113 0.07
114 0.07
115 0.07
116 0.07
117 0.07
118 0.06
119 0.06
120 0.06
121 0.08
122 0.15
123 0.16
124 0.17
125 0.19
126 0.2
127 0.23
128 0.25
129 0.27
130 0.23
131 0.25
132 0.26
133 0.26
134 0.29
135 0.28
136 0.25
137 0.22
138 0.23
139 0.21
140 0.19
141 0.19
142 0.16
143 0.18
144 0.23
145 0.22
146 0.19
147 0.22
148 0.22
149 0.23
150 0.29
151 0.32
152 0.31
153 0.41
154 0.5
155 0.5
156 0.56