Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C0NTS3

Protein Details
Accession C0NTS3    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
172-199AVEIVQRTEKRKRRARLTYMRKPKHDMGHydrophilic
NLS Segment(s)
PositionSequence
181-188KRKRRARL
Subcellular Location(s) mito 12, cyto 9.5, cyto_nucl 8, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038657  L19_sf  
IPR001857  Ribosomal_L19  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01245  Ribosomal_L19  
Amino Acid Sequences MAAPMSTMRPLGCWNLVRRGLKGHELGRRLLYTIYSPPKDKLPFPKDLPQQFMRQIPNIHRPDRVVGRKIKVPPPPPSKCKTTKDPVAAFTADQLAIYDPTGERKAMFDKRNPHCVRVGDVLRVTFKSGDPFAGVCLNIRSRGLDTSFLLRNKLTRIGCEMWIKVFSPLVQAVEIVQRTEKRKRRARLTYMRKPKHDMGSVEGIVRQYMRNRSQQQGTSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.38
3 0.45
4 0.46
5 0.45
6 0.47
7 0.46
8 0.46
9 0.48
10 0.45
11 0.45
12 0.46
13 0.47
14 0.44
15 0.41
16 0.36
17 0.3
18 0.25
19 0.21
20 0.26
21 0.32
22 0.32
23 0.33
24 0.34
25 0.41
26 0.43
27 0.45
28 0.48
29 0.46
30 0.5
31 0.53
32 0.61
33 0.62
34 0.64
35 0.64
36 0.57
37 0.56
38 0.52
39 0.53
40 0.47
41 0.42
42 0.42
43 0.41
44 0.48
45 0.49
46 0.47
47 0.43
48 0.41
49 0.43
50 0.48
51 0.48
52 0.45
53 0.45
54 0.47
55 0.51
56 0.55
57 0.56
58 0.54
59 0.54
60 0.57
61 0.61
62 0.65
63 0.65
64 0.63
65 0.64
66 0.65
67 0.65
68 0.63
69 0.61
70 0.61
71 0.62
72 0.6
73 0.55
74 0.49
75 0.44
76 0.36
77 0.28
78 0.22
79 0.14
80 0.11
81 0.09
82 0.06
83 0.06
84 0.06
85 0.06
86 0.05
87 0.08
88 0.09
89 0.09
90 0.08
91 0.09
92 0.15
93 0.22
94 0.25
95 0.27
96 0.36
97 0.4
98 0.51
99 0.51
100 0.47
101 0.44
102 0.41
103 0.4
104 0.36
105 0.34
106 0.26
107 0.25
108 0.24
109 0.21
110 0.21
111 0.18
112 0.13
113 0.12
114 0.12
115 0.11
116 0.11
117 0.11
118 0.1
119 0.1
120 0.11
121 0.1
122 0.08
123 0.1
124 0.11
125 0.11
126 0.11
127 0.11
128 0.11
129 0.14
130 0.14
131 0.14
132 0.14
133 0.18
134 0.23
135 0.22
136 0.23
137 0.21
138 0.21
139 0.21
140 0.27
141 0.23
142 0.2
143 0.26
144 0.27
145 0.31
146 0.33
147 0.31
148 0.25
149 0.26
150 0.25
151 0.2
152 0.18
153 0.14
154 0.14
155 0.14
156 0.14
157 0.12
158 0.11
159 0.11
160 0.15
161 0.16
162 0.13
163 0.16
164 0.2
165 0.25
166 0.36
167 0.43
168 0.49
169 0.58
170 0.67
171 0.74
172 0.8
173 0.85
174 0.86
175 0.88
176 0.89
177 0.91
178 0.9
179 0.85
180 0.81
181 0.78
182 0.75
183 0.72
184 0.63
185 0.58
186 0.57
187 0.53
188 0.47
189 0.41
190 0.33
191 0.26
192 0.25
193 0.22
194 0.21
195 0.29
196 0.33
197 0.42
198 0.47
199 0.54
200 0.61