Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9N6Y0

Protein Details
Accession A0A1L9N6Y0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
19-44PPSLLIFRCRWRRKSKRENDGRDTGHHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 16, mito 7, cyto 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAWSKATIIALVTLLVTGPPSLLIFRCRWRRKSKRENDGRDTGHGETNGWVARRDSRYDVPRGEWAFLPFSLGLYASGTGIEVGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.05
4 0.04
5 0.04
6 0.04
7 0.05
8 0.06
9 0.07
10 0.11
11 0.14
12 0.22
13 0.33
14 0.4
15 0.48
16 0.58
17 0.67
18 0.75
19 0.83
20 0.85
21 0.85
22 0.89
23 0.9
24 0.85
25 0.82
26 0.73
27 0.64
28 0.56
29 0.46
30 0.37
31 0.29
32 0.22
33 0.15
34 0.15
35 0.14
36 0.12
37 0.11
38 0.11
39 0.16
40 0.19
41 0.21
42 0.24
43 0.3
44 0.35
45 0.39
46 0.4
47 0.37
48 0.42
49 0.4
50 0.37
51 0.31
52 0.29
53 0.26
54 0.24
55 0.23
56 0.16
57 0.15
58 0.14
59 0.12
60 0.11
61 0.1
62 0.1
63 0.08
64 0.08
65 0.07