Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9N4F8

Protein Details
Accession A0A1L9N4F8    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
36-68QRALDRIVTRRNRNRRRAIRRRERVRARITDVVHydrophilic
NLS Segment(s)
PositionSequence
45-62RRNRNRRRAIRRRERVRA
Subcellular Location(s) mito 8, extr 8, cyto 3, plas 3, nucl 2, pero 2
Family & Domain DBs
Amino Acid Sequences MNLYVELAVTARLLILVQSLMVSHRPGTRVNLTETQRALDRIVTRRNRNRRRAIRRRERVRARITDVVSTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.04
5 0.04
6 0.04
7 0.05
8 0.07
9 0.07
10 0.09
11 0.11
12 0.12
13 0.14
14 0.18
15 0.22
16 0.22
17 0.26
18 0.31
19 0.31
20 0.33
21 0.32
22 0.29
23 0.25
24 0.24
25 0.2
26 0.16
27 0.18
28 0.2
29 0.29
30 0.35
31 0.44
32 0.53
33 0.64
34 0.71
35 0.76
36 0.82
37 0.84
38 0.88
39 0.9
40 0.92
41 0.92
42 0.93
43 0.93
44 0.93
45 0.93
46 0.91
47 0.89
48 0.86
49 0.82
50 0.78
51 0.71