Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9NMT0

Protein Details
Accession A0A1L9NMT0    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
325-346EQPTGEGRRRSKRLDSRRINPAHydrophilic
NLS Segment(s)
PositionSequence
29-52SRRKAAAKIKRKPVGAAAAAAPKT
319-321KRK
329-342GEGRRRSKRLDSRR
Subcellular Location(s) cyto 21, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002048  EF_hand_dom  
Gene Ontology GO:0005509  F:calcium ion binding  
PROSITE View protein in PROSITE  
PS50222  EF_HAND_2  
Amino Acid Sequences TMDLHPQTITPQTFQHLLSLYPKKVDLLSRRKAAAKIKRKPVGAAAAAAPKTKQKSSWTATGTRSEAEEEFITAKANEFLALDGFRYEGLPGMVATRAEKDGNGYLEKDELVKLMEWKMQHGTFRPALLGMIRSNSEAVVRDATGKAFKALTAHHTSKEGDEEEKKFPSEALDILTKALRGVGVATASLVLSLASTADVPFYSDDVYLWVCMEEVPSPSTSVKRGVYKRLNGELNVKYTMKEYRELWEGVKGLKERLEGKEKGVSGLDVEKVALVVRYYYALLGGGQSVDGDGDGGGGDKKRSEGMKVEEEEETTKREKRKLEDEQPTGEGRRRSKRLDSRRINPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.23
4 0.24
5 0.31
6 0.36
7 0.34
8 0.33
9 0.33
10 0.31
11 0.33
12 0.39
13 0.41
14 0.43
15 0.5
16 0.53
17 0.56
18 0.59
19 0.62
20 0.64
21 0.64
22 0.65
23 0.67
24 0.72
25 0.75
26 0.72
27 0.69
28 0.65
29 0.62
30 0.53
31 0.46
32 0.38
33 0.38
34 0.37
35 0.35
36 0.3
37 0.27
38 0.3
39 0.3
40 0.31
41 0.3
42 0.39
43 0.43
44 0.51
45 0.5
46 0.51
47 0.53
48 0.54
49 0.49
50 0.41
51 0.36
52 0.31
53 0.26
54 0.23
55 0.2
56 0.15
57 0.15
58 0.14
59 0.14
60 0.12
61 0.12
62 0.1
63 0.1
64 0.09
65 0.08
66 0.09
67 0.09
68 0.09
69 0.09
70 0.08
71 0.08
72 0.07
73 0.07
74 0.07
75 0.06
76 0.06
77 0.06
78 0.06
79 0.07
80 0.08
81 0.08
82 0.09
83 0.09
84 0.11
85 0.11
86 0.11
87 0.13
88 0.15
89 0.17
90 0.18
91 0.17
92 0.15
93 0.16
94 0.16
95 0.14
96 0.11
97 0.09
98 0.09
99 0.09
100 0.1
101 0.11
102 0.13
103 0.13
104 0.15
105 0.18
106 0.19
107 0.2
108 0.21
109 0.24
110 0.23
111 0.23
112 0.22
113 0.18
114 0.16
115 0.15
116 0.14
117 0.1
118 0.1
119 0.1
120 0.1
121 0.1
122 0.1
123 0.1
124 0.09
125 0.1
126 0.09
127 0.09
128 0.1
129 0.1
130 0.11
131 0.12
132 0.11
133 0.1
134 0.09
135 0.09
136 0.09
137 0.1
138 0.14
139 0.2
140 0.21
141 0.21
142 0.23
143 0.23
144 0.22
145 0.24
146 0.19
147 0.16
148 0.18
149 0.21
150 0.22
151 0.22
152 0.22
153 0.19
154 0.18
155 0.17
156 0.13
157 0.11
158 0.1
159 0.1
160 0.1
161 0.11
162 0.11
163 0.09
164 0.08
165 0.07
166 0.05
167 0.04
168 0.04
169 0.04
170 0.04
171 0.04
172 0.04
173 0.04
174 0.04
175 0.04
176 0.03
177 0.03
178 0.02
179 0.02
180 0.03
181 0.03
182 0.03
183 0.03
184 0.03
185 0.03
186 0.04
187 0.05
188 0.05
189 0.06
190 0.06
191 0.06
192 0.07
193 0.07
194 0.06
195 0.06
196 0.06
197 0.05
198 0.05
199 0.06
200 0.06
201 0.07
202 0.08
203 0.08
204 0.1
205 0.11
206 0.12
207 0.13
208 0.16
209 0.18
210 0.25
211 0.28
212 0.37
213 0.43
214 0.48
215 0.52
216 0.54
217 0.53
218 0.47
219 0.5
220 0.44
221 0.39
222 0.37
223 0.32
224 0.25
225 0.25
226 0.28
227 0.23
228 0.24
229 0.22
230 0.23
231 0.26
232 0.27
233 0.26
234 0.25
235 0.24
236 0.22
237 0.25
238 0.22
239 0.2
240 0.21
241 0.23
242 0.23
243 0.27
244 0.34
245 0.31
246 0.33
247 0.37
248 0.35
249 0.33
250 0.3
251 0.24
252 0.18
253 0.2
254 0.17
255 0.12
256 0.12
257 0.1
258 0.09
259 0.1
260 0.09
261 0.06
262 0.06
263 0.06
264 0.07
265 0.08
266 0.08
267 0.07
268 0.07
269 0.07
270 0.07
271 0.07
272 0.06
273 0.05
274 0.05
275 0.05
276 0.04
277 0.04
278 0.04
279 0.03
280 0.03
281 0.03
282 0.04
283 0.06
284 0.08
285 0.09
286 0.09
287 0.1
288 0.15
289 0.16
290 0.19
291 0.25
292 0.3
293 0.38
294 0.39
295 0.41
296 0.37
297 0.38
298 0.37
299 0.32
300 0.3
301 0.26
302 0.29
303 0.33
304 0.38
305 0.43
306 0.48
307 0.57
308 0.63
309 0.7
310 0.74
311 0.74
312 0.72
313 0.69
314 0.65
315 0.58
316 0.53
317 0.5
318 0.48
319 0.53
320 0.55
321 0.58
322 0.65
323 0.72
324 0.78
325 0.82
326 0.84