Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9N0Z9

Protein Details
Accession A0A1L9N0Z9    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
48-67KDAMRCLKRRLENKNPNIQLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 12.333, cyto 5, cyto_pero 3.999, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR008942  ENTH_VHS  
IPR002014  VHS_dom  
Gene Ontology GO:0016020  C:membrane  
GO:0035091  F:phosphatidylinositol binding  
GO:0043130  F:ubiquitin binding  
GO:0006886  P:intracellular protein transport  
GO:0007034  P:vacuolar transport  
GO:0016192  P:vesicle-mediated transport  
Pfam View protein in Pfam  
PF00790  VHS  
PROSITE View protein in PROSITE  
PS50179  VHS  
Amino Acid Sequences MSYFDGDRPVNGPHPVNHQLTSNNWRREDIALNLEISDLIRSKGVQPKDAMRCLKRRLENKNPNIQLATLKVDYPTSLQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.37
3 0.37
4 0.35
5 0.33
6 0.32
7 0.35
8 0.41
9 0.43
10 0.42
11 0.41
12 0.41
13 0.4
14 0.4
15 0.38
16 0.32
17 0.26
18 0.21
19 0.2
20 0.19
21 0.17
22 0.14
23 0.11
24 0.09
25 0.06
26 0.05
27 0.05
28 0.05
29 0.09
30 0.15
31 0.16
32 0.18
33 0.2
34 0.27
35 0.33
36 0.39
37 0.42
38 0.41
39 0.47
40 0.5
41 0.56
42 0.56
43 0.59
44 0.62
45 0.68
46 0.74
47 0.75
48 0.8
49 0.74
50 0.69
51 0.62
52 0.53
53 0.45
54 0.37
55 0.34
56 0.24
57 0.22
58 0.21
59 0.2
60 0.2