Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9MUY1

Protein Details
Accession A0A1L9MUY1    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
19-44VPKTRRTYCKSKECHKHTQHKVTQYKHydrophilic
88-108ECTACKTKKQLSLKRCKHFELHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, cyto_nucl 9.5, mito 7, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MEFSTGELPRDQLWDEVNVPKTRRTYCKSKECHKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKIVLRLECTACKTKKQLSLKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.2
3 0.25
4 0.3
5 0.32
6 0.33
7 0.35
8 0.39
9 0.42
10 0.48
11 0.48
12 0.53
13 0.58
14 0.66
15 0.7
16 0.75
17 0.8
18 0.79
19 0.84
20 0.83
21 0.84
22 0.83
23 0.86
24 0.81
25 0.81
26 0.79
27 0.72
28 0.7
29 0.64
30 0.59
31 0.51
32 0.47
33 0.37
34 0.32
35 0.31
36 0.3
37 0.29
38 0.26
39 0.31
40 0.35
41 0.39
42 0.43
43 0.48
44 0.44
45 0.51
46 0.58
47 0.55
48 0.57
49 0.55
50 0.55
51 0.54
52 0.57
53 0.48
54 0.44
55 0.4
56 0.34
57 0.36
58 0.38
59 0.37
60 0.32
61 0.39
62 0.43
63 0.52
64 0.61
65 0.64
66 0.63
67 0.66
68 0.73
69 0.74
70 0.72
71 0.69
72 0.64
73 0.61
74 0.6
75 0.54
76 0.5
77 0.5
78 0.44
79 0.42
80 0.43
81 0.45
82 0.49
83 0.57
84 0.62
85 0.64
86 0.74
87 0.79
88 0.83
89 0.81
90 0.76
91 0.7
92 0.64
93 0.61
94 0.61
95 0.6
96 0.58
97 0.58
98 0.54
99 0.51
100 0.49
101 0.42