Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9MWT2

Protein Details
Accession A0A1L9MWT2   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
160-189PYSAAFRVRRTPKPQKKHTKQVYKKLKLTSHydrophilic
NLS Segment(s)
PositionSequence
169-177RTPKPQKKH
Subcellular Location(s) cyto_nucl 8, nucl 7, mito 7, cyto 7, plas 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011388  DES1/DES2  
IPR005804  FA_desaturase_dom  
IPR013866  Sphingolipid_d4-desaturase_N  
Gene Ontology GO:0016020  C:membrane  
GO:0042284  F:sphingolipid delta-4 desaturase activity  
GO:0030148  P:sphingolipid biosynthetic process  
Pfam View protein in Pfam  
PF00487  FA_desaturase  
PF08557  Lipid_DES  
CDD cd03508  Delta4-sphingolipid-FADS-like  
Amino Acid Sequences MSSSVVEATADASPHLRVSASKGQAAQATPDKTEPSTRIDPPETSAVDDHFFWTYTEEPHRSRRQAIIKAHPEVTKLCGPEPLTKYVVLGVVSLQVLCAYLLRNTSMLDWKFLATAYVIGATSNQNLFLAIHEISHNLAFRSAMANRLLAIFANIPIGLPYSAAFRVRRTPKPQKKHTKQVYKKLKLTSPASQPYHLTHHKSLGVAGLDTDLPTAVEAFLLDSILGKAFFCTFQILFYAVRPMFIYSPPFTSIHVLNLITQLTFDYALTKLCGGSLQPLLYLLLSSFLAGSLHPCAGHFIAEHYFFSQVGHGTESIQEQKNNQKKKPHPLDSLPPPETYSYYGPLNFFTYNVGLHNEHHDFPAIPWTRLHELHRIASEFYEPLPCHHSWVWVIWTFILDKNVGMWCRVKRAQGGRLVGGGGGRAGESISASSAGPEGESGDGWKESEIQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.11
4 0.1
5 0.18
6 0.27
7 0.29
8 0.32
9 0.33
10 0.35
11 0.38
12 0.38
13 0.36
14 0.34
15 0.33
16 0.32
17 0.33
18 0.33
19 0.31
20 0.36
21 0.32
22 0.32
23 0.36
24 0.39
25 0.44
26 0.45
27 0.44
28 0.42
29 0.47
30 0.39
31 0.36
32 0.33
33 0.27
34 0.26
35 0.25
36 0.22
37 0.17
38 0.16
39 0.14
40 0.16
41 0.15
42 0.18
43 0.25
44 0.29
45 0.32
46 0.41
47 0.5
48 0.51
49 0.54
50 0.58
51 0.6
52 0.63
53 0.67
54 0.69
55 0.67
56 0.68
57 0.68
58 0.6
59 0.53
60 0.46
61 0.43
62 0.36
63 0.3
64 0.26
65 0.26
66 0.28
67 0.35
68 0.37
69 0.36
70 0.34
71 0.32
72 0.32
73 0.28
74 0.27
75 0.19
76 0.15
77 0.1
78 0.11
79 0.11
80 0.1
81 0.08
82 0.06
83 0.07
84 0.06
85 0.07
86 0.06
87 0.07
88 0.09
89 0.1
90 0.1
91 0.1
92 0.13
93 0.2
94 0.19
95 0.2
96 0.2
97 0.19
98 0.19
99 0.19
100 0.17
101 0.09
102 0.09
103 0.07
104 0.08
105 0.07
106 0.07
107 0.08
108 0.09
109 0.1
110 0.1
111 0.1
112 0.08
113 0.09
114 0.09
115 0.09
116 0.1
117 0.08
118 0.09
119 0.09
120 0.09
121 0.1
122 0.11
123 0.11
124 0.09
125 0.09
126 0.08
127 0.08
128 0.12
129 0.11
130 0.13
131 0.14
132 0.13
133 0.13
134 0.14
135 0.13
136 0.1
137 0.1
138 0.07
139 0.07
140 0.07
141 0.07
142 0.06
143 0.06
144 0.07
145 0.06
146 0.06
147 0.06
148 0.07
149 0.09
150 0.12
151 0.13
152 0.14
153 0.23
154 0.3
155 0.37
156 0.45
157 0.55
158 0.62
159 0.72
160 0.81
161 0.83
162 0.86
163 0.89
164 0.9
165 0.89
166 0.88
167 0.89
168 0.89
169 0.86
170 0.83
171 0.77
172 0.7
173 0.66
174 0.61
175 0.57
176 0.54
177 0.53
178 0.49
179 0.45
180 0.43
181 0.38
182 0.41
183 0.38
184 0.35
185 0.29
186 0.3
187 0.3
188 0.29
189 0.27
190 0.22
191 0.18
192 0.12
193 0.11
194 0.09
195 0.07
196 0.07
197 0.06
198 0.04
199 0.04
200 0.04
201 0.04
202 0.03
203 0.03
204 0.03
205 0.03
206 0.03
207 0.03
208 0.03
209 0.03
210 0.03
211 0.04
212 0.04
213 0.03
214 0.04
215 0.04
216 0.05
217 0.05
218 0.07
219 0.07
220 0.07
221 0.08
222 0.09
223 0.09
224 0.09
225 0.14
226 0.12
227 0.12
228 0.12
229 0.12
230 0.12
231 0.13
232 0.16
233 0.12
234 0.14
235 0.16
236 0.16
237 0.15
238 0.17
239 0.16
240 0.14
241 0.15
242 0.13
243 0.11
244 0.12
245 0.12
246 0.09
247 0.09
248 0.07
249 0.06
250 0.06
251 0.06
252 0.06
253 0.06
254 0.07
255 0.07
256 0.07
257 0.06
258 0.06
259 0.07
260 0.05
261 0.08
262 0.09
263 0.09
264 0.09
265 0.09
266 0.09
267 0.09
268 0.09
269 0.05
270 0.05
271 0.05
272 0.05
273 0.04
274 0.04
275 0.05
276 0.05
277 0.06
278 0.06
279 0.07
280 0.07
281 0.07
282 0.09
283 0.09
284 0.1
285 0.09
286 0.09
287 0.12
288 0.13
289 0.13
290 0.12
291 0.12
292 0.12
293 0.12
294 0.11
295 0.09
296 0.09
297 0.1
298 0.09
299 0.09
300 0.11
301 0.13
302 0.18
303 0.19
304 0.2
305 0.22
306 0.32
307 0.4
308 0.47
309 0.49
310 0.54
311 0.59
312 0.69
313 0.77
314 0.76
315 0.75
316 0.73
317 0.77
318 0.77
319 0.78
320 0.68
321 0.58
322 0.51
323 0.44
324 0.39
325 0.34
326 0.26
327 0.2
328 0.2
329 0.21
330 0.2
331 0.21
332 0.22
333 0.19
334 0.17
335 0.16
336 0.15
337 0.14
338 0.14
339 0.16
340 0.14
341 0.15
342 0.21
343 0.22
344 0.22
345 0.22
346 0.22
347 0.19
348 0.19
349 0.28
350 0.24
351 0.22
352 0.22
353 0.27
354 0.3
355 0.33
356 0.36
357 0.34
358 0.35
359 0.38
360 0.41
361 0.38
362 0.34
363 0.31
364 0.3
365 0.23
366 0.2
367 0.22
368 0.19
369 0.19
370 0.24
371 0.23
372 0.26
373 0.26
374 0.29
375 0.24
376 0.27
377 0.3
378 0.27
379 0.28
380 0.22
381 0.23
382 0.21
383 0.22
384 0.21
385 0.16
386 0.13
387 0.15
388 0.2
389 0.19
390 0.2
391 0.24
392 0.24
393 0.33
394 0.37
395 0.38
396 0.42
397 0.5
398 0.55
399 0.57
400 0.58
401 0.51
402 0.49
403 0.45
404 0.37
405 0.29
406 0.22
407 0.14
408 0.09
409 0.07
410 0.06
411 0.06
412 0.06
413 0.06
414 0.06
415 0.07
416 0.08
417 0.08
418 0.08
419 0.09
420 0.09
421 0.08
422 0.08
423 0.08
424 0.08
425 0.09
426 0.1
427 0.12
428 0.12
429 0.13
430 0.13