Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9MVN6

Protein Details
Accession A0A1L9MVN6   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
190-219VTYKRTQLEDPPKGKRRKHNETKQEEEDEEBasic
NLS Segment(s)
PositionSequence
202-207KGKRRK
Subcellular Location(s) nucl 15, mito_nucl 11.333, cyto_nucl 9.833, mito 6.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MPAKPILHPLRTPKNMTFPSELQPDNGVRLGAPGKQQDESLSTPITPPAAYTEFLKSFTPVFTPDGNGGTVTRFVWDKANKTPTSQPASAVSGSFSFPEPTRPATATLPPPSPYGSAPHGRDMMSLRRLRIPPPMRYSPTLETPRSATTPVLSPYSYSYSPADWKMRYWDGPRSATVGRVSVRHVVTHTVTYKRTQLEDPPKGKRRKHNETKQEEEDEEDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.61
3 0.61
4 0.58
5 0.5
6 0.5
7 0.51
8 0.47
9 0.38
10 0.38
11 0.34
12 0.3
13 0.28
14 0.22
15 0.15
16 0.18
17 0.18
18 0.17
19 0.2
20 0.22
21 0.23
22 0.24
23 0.25
24 0.23
25 0.26
26 0.26
27 0.24
28 0.21
29 0.18
30 0.18
31 0.19
32 0.18
33 0.13
34 0.11
35 0.13
36 0.14
37 0.14
38 0.16
39 0.2
40 0.2
41 0.22
42 0.22
43 0.19
44 0.18
45 0.17
46 0.17
47 0.13
48 0.15
49 0.14
50 0.15
51 0.16
52 0.16
53 0.16
54 0.15
55 0.13
56 0.11
57 0.11
58 0.09
59 0.09
60 0.08
61 0.09
62 0.16
63 0.19
64 0.21
65 0.28
66 0.35
67 0.34
68 0.37
69 0.42
70 0.42
71 0.45
72 0.42
73 0.36
74 0.31
75 0.33
76 0.3
77 0.25
78 0.19
79 0.13
80 0.13
81 0.12
82 0.1
83 0.09
84 0.08
85 0.12
86 0.13
87 0.14
88 0.16
89 0.16
90 0.18
91 0.18
92 0.22
93 0.23
94 0.24
95 0.23
96 0.23
97 0.23
98 0.21
99 0.2
100 0.17
101 0.16
102 0.17
103 0.2
104 0.2
105 0.22
106 0.22
107 0.21
108 0.22
109 0.22
110 0.23
111 0.25
112 0.26
113 0.24
114 0.29
115 0.3
116 0.3
117 0.38
118 0.38
119 0.38
120 0.43
121 0.48
122 0.46
123 0.48
124 0.51
125 0.45
126 0.47
127 0.46
128 0.4
129 0.35
130 0.34
131 0.34
132 0.3
133 0.28
134 0.2
135 0.15
136 0.18
137 0.18
138 0.18
139 0.15
140 0.15
141 0.16
142 0.21
143 0.19
144 0.19
145 0.18
146 0.18
147 0.21
148 0.25
149 0.27
150 0.24
151 0.25
152 0.29
153 0.32
154 0.35
155 0.35
156 0.39
157 0.4
158 0.42
159 0.41
160 0.39
161 0.36
162 0.35
163 0.32
164 0.28
165 0.23
166 0.22
167 0.24
168 0.26
169 0.26
170 0.24
171 0.24
172 0.24
173 0.25
174 0.29
175 0.31
176 0.29
177 0.3
178 0.32
179 0.36
180 0.35
181 0.36
182 0.34
183 0.39
184 0.45
185 0.54
186 0.58
187 0.64
188 0.7
189 0.76
190 0.81
191 0.82
192 0.81
193 0.83
194 0.87
195 0.87
196 0.88
197 0.89
198 0.9
199 0.86
200 0.82
201 0.71