Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9NJS3

Protein Details
Accession A0A1L9NJS3    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
24-50GIYLLIKHRRERKRERREDKLRAQYYRBasic
NLS Segment(s)
PositionSequence
30-42KHRRERKRERRED
Subcellular Location(s) mito 11, cyto_nucl 6.5, nucl 6, cyto 5, plas 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSIGKIIGKIIIIPIIIIIAICVGIYLLIKHRRERKRERREDKLRAQYYRQQYQQQYMYPHMQMQSQQQQQQQQPGTPAPPYYNQAYSAGQQPVAMNEGEYGYSETMMKKPEPVVYPVQQQHPGSEVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.07
4 0.06
5 0.05
6 0.03
7 0.03
8 0.03
9 0.03
10 0.02
11 0.03
12 0.03
13 0.04
14 0.11
15 0.19
16 0.22
17 0.29
18 0.39
19 0.48
20 0.57
21 0.68
22 0.72
23 0.76
24 0.85
25 0.87
26 0.88
27 0.9
28 0.9
29 0.89
30 0.88
31 0.83
32 0.75
33 0.71
34 0.68
35 0.65
36 0.63
37 0.57
38 0.53
39 0.49
40 0.5
41 0.49
42 0.44
43 0.39
44 0.35
45 0.34
46 0.27
47 0.27
48 0.22
49 0.19
50 0.17
51 0.2
52 0.25
53 0.26
54 0.29
55 0.31
56 0.36
57 0.37
58 0.42
59 0.38
60 0.31
61 0.3
62 0.27
63 0.26
64 0.21
65 0.2
66 0.15
67 0.17
68 0.18
69 0.19
70 0.19
71 0.19
72 0.2
73 0.21
74 0.2
75 0.23
76 0.22
77 0.19
78 0.18
79 0.17
80 0.15
81 0.15
82 0.14
83 0.08
84 0.08
85 0.08
86 0.08
87 0.08
88 0.09
89 0.08
90 0.08
91 0.09
92 0.1
93 0.12
94 0.15
95 0.15
96 0.16
97 0.19
98 0.24
99 0.26
100 0.29
101 0.34
102 0.35
103 0.44
104 0.46
105 0.49
106 0.5
107 0.48
108 0.45