Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9NK71

Protein Details
Accession A0A1L9NK71    Localization Confidence Low Confidence Score 5.6
NoLS Segment(s)
PositionSequenceProtein Nature
288-307ILKAVRKRYLPKKYRVVAEKHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 10, mito 7.5, cyto_mito 7, cyto 5.5, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008928  6-hairpin_glycosidase_sf  
IPR012341  6hp_glycosidase-like_sf  
IPR010905  Glyco_hydro_88  
Gene Ontology GO:0005975  P:carbohydrate metabolic process  
Pfam View protein in Pfam  
PF07470  Glyco_hydro_88  
Amino Acid Sequences MASTSPPAVRSKIDLLITNLVNIQDKTGQFLLPLADGRIIDTKSWHGWEWTHGIGLYGIWKYYEMTGSPHLLQIIEDWFAARFAEGGTTKNINTMAVFLTLAYVYEKTQNPVYLPWLDSWAEWAMHELPRTKQGGMQHATYLTENYQQLWDDTLMMTVMPLAKIGKLLNRPEYVEEAKRQTLVHVKYLVDTSTGLWFHGWTFEEGGHNFARARWARGNSWVTMVIPEFVELLELKETDPIRLFLLDTLEAQCEALMGLQEESGFWHTLLDHPDSYVEASATAGFAYGILKAVRKRYLPKKYRVVAEKAVQAVLGAVDETGELQQTSFGTGMGDSLEFYKKIPLTAMPYGQAMAIMALGEYLRGFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.35
3 0.39
4 0.37
5 0.33
6 0.3
7 0.26
8 0.26
9 0.23
10 0.21
11 0.2
12 0.2
13 0.25
14 0.24
15 0.23
16 0.2
17 0.21
18 0.2
19 0.16
20 0.17
21 0.13
22 0.14
23 0.13
24 0.16
25 0.19
26 0.18
27 0.17
28 0.18
29 0.21
30 0.23
31 0.25
32 0.24
33 0.22
34 0.22
35 0.26
36 0.28
37 0.25
38 0.23
39 0.2
40 0.2
41 0.17
42 0.16
43 0.16
44 0.11
45 0.11
46 0.1
47 0.1
48 0.11
49 0.12
50 0.13
51 0.11
52 0.14
53 0.17
54 0.2
55 0.2
56 0.2
57 0.19
58 0.17
59 0.17
60 0.15
61 0.13
62 0.11
63 0.1
64 0.09
65 0.09
66 0.09
67 0.09
68 0.07
69 0.06
70 0.05
71 0.09
72 0.1
73 0.11
74 0.14
75 0.16
76 0.16
77 0.18
78 0.18
79 0.14
80 0.14
81 0.14
82 0.11
83 0.1
84 0.1
85 0.07
86 0.08
87 0.07
88 0.07
89 0.07
90 0.07
91 0.07
92 0.13
93 0.14
94 0.16
95 0.18
96 0.19
97 0.19
98 0.2
99 0.23
100 0.19
101 0.19
102 0.18
103 0.18
104 0.18
105 0.16
106 0.18
107 0.15
108 0.13
109 0.12
110 0.13
111 0.13
112 0.14
113 0.16
114 0.16
115 0.15
116 0.21
117 0.23
118 0.21
119 0.21
120 0.24
121 0.3
122 0.3
123 0.3
124 0.26
125 0.25
126 0.25
127 0.23
128 0.2
129 0.12
130 0.14
131 0.13
132 0.13
133 0.13
134 0.12
135 0.12
136 0.13
137 0.12
138 0.08
139 0.08
140 0.07
141 0.06
142 0.06
143 0.05
144 0.04
145 0.05
146 0.04
147 0.04
148 0.04
149 0.05
150 0.06
151 0.07
152 0.11
153 0.15
154 0.18
155 0.22
156 0.23
157 0.24
158 0.24
159 0.28
160 0.26
161 0.24
162 0.24
163 0.23
164 0.22
165 0.23
166 0.21
167 0.19
168 0.23
169 0.22
170 0.23
171 0.22
172 0.21
173 0.21
174 0.22
175 0.2
176 0.13
177 0.12
178 0.09
179 0.1
180 0.1
181 0.09
182 0.08
183 0.08
184 0.08
185 0.1
186 0.1
187 0.07
188 0.08
189 0.08
190 0.1
191 0.1
192 0.13
193 0.11
194 0.11
195 0.11
196 0.1
197 0.17
198 0.16
199 0.21
200 0.23
201 0.26
202 0.26
203 0.34
204 0.36
205 0.29
206 0.3
207 0.26
208 0.21
209 0.2
210 0.18
211 0.12
212 0.09
213 0.09
214 0.07
215 0.06
216 0.06
217 0.05
218 0.06
219 0.06
220 0.06
221 0.06
222 0.11
223 0.11
224 0.12
225 0.13
226 0.13
227 0.13
228 0.13
229 0.13
230 0.1
231 0.12
232 0.11
233 0.11
234 0.11
235 0.11
236 0.1
237 0.1
238 0.08
239 0.06
240 0.06
241 0.05
242 0.04
243 0.05
244 0.05
245 0.05
246 0.05
247 0.05
248 0.07
249 0.08
250 0.09
251 0.08
252 0.08
253 0.08
254 0.12
255 0.15
256 0.17
257 0.15
258 0.14
259 0.15
260 0.15
261 0.16
262 0.13
263 0.1
264 0.07
265 0.07
266 0.07
267 0.07
268 0.06
269 0.05
270 0.04
271 0.04
272 0.05
273 0.04
274 0.06
275 0.07
276 0.11
277 0.14
278 0.19
279 0.24
280 0.28
281 0.38
282 0.46
283 0.57
284 0.63
285 0.69
286 0.74
287 0.76
288 0.8
289 0.78
290 0.74
291 0.7
292 0.66
293 0.62
294 0.53
295 0.47
296 0.37
297 0.3
298 0.23
299 0.16
300 0.11
301 0.06
302 0.04
303 0.04
304 0.04
305 0.05
306 0.05
307 0.05
308 0.05
309 0.05
310 0.07
311 0.07
312 0.09
313 0.08
314 0.08
315 0.08
316 0.08
317 0.08
318 0.08
319 0.08
320 0.07
321 0.09
322 0.12
323 0.12
324 0.13
325 0.19
326 0.19
327 0.2
328 0.21
329 0.23
330 0.27
331 0.33
332 0.35
333 0.3
334 0.3
335 0.29
336 0.27
337 0.23
338 0.16
339 0.1
340 0.08
341 0.06
342 0.05
343 0.05
344 0.05
345 0.05