Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9N1V5

Protein Details
Accession A0A1L9N1V5   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22LRYAQRRRQRQPALQRNRQFHIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 8, cyto 3
Family & Domain DBs
Amino Acid Sequences LRYAQRRRQRQPALQRNRQFHIIQDEYVPTRYTTAQSDLSTRTTSRLTYRFCLQRRVPPASESATTRLTLFAGVVVSIYTTPKIYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.88
3 0.83
4 0.77
5 0.72
6 0.61
7 0.54
8 0.52
9 0.44
10 0.37
11 0.32
12 0.31
13 0.27
14 0.27
15 0.24
16 0.15
17 0.14
18 0.14
19 0.15
20 0.14
21 0.16
22 0.17
23 0.17
24 0.19
25 0.19
26 0.2
27 0.2
28 0.18
29 0.16
30 0.14
31 0.15
32 0.17
33 0.21
34 0.22
35 0.24
36 0.3
37 0.37
38 0.38
39 0.45
40 0.44
41 0.46
42 0.49
43 0.53
44 0.49
45 0.42
46 0.43
47 0.38
48 0.38
49 0.32
50 0.29
51 0.24
52 0.23
53 0.22
54 0.19
55 0.16
56 0.14
57 0.11
58 0.09
59 0.07
60 0.06
61 0.06
62 0.05
63 0.06
64 0.06
65 0.08
66 0.08