Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9N906

Protein Details
Accession A0A1L9N906    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
15-41LPNNYPTPSRANKKRRVRKGIDLHPLRHydrophilic
NLS Segment(s)
PositionSequence
25-33ANKKRRVRK
Subcellular Location(s) nucl 12, cyto 7, mito 6
Family & Domain DBs
Amino Acid Sequences MVYPLTTNEPLLPHLPNNYPTPSRANKKRRVRKGIDLHPLRSKQQELQFQLCLPSHHPRTFGGNFPRAANYPPIDGYNSFRVLRAGGGAILYPRRLKWS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.25
3 0.26
4 0.29
5 0.31
6 0.3
7 0.3
8 0.36
9 0.4
10 0.46
11 0.53
12 0.6
13 0.65
14 0.75
15 0.83
16 0.86
17 0.88
18 0.85
19 0.85
20 0.85
21 0.84
22 0.83
23 0.77
24 0.7
25 0.67
26 0.62
27 0.54
28 0.47
29 0.39
30 0.34
31 0.37
32 0.4
33 0.37
34 0.38
35 0.36
36 0.33
37 0.34
38 0.29
39 0.23
40 0.19
41 0.22
42 0.24
43 0.25
44 0.26
45 0.25
46 0.31
47 0.33
48 0.36
49 0.35
50 0.34
51 0.34
52 0.34
53 0.35
54 0.29
55 0.29
56 0.27
57 0.22
58 0.19
59 0.19
60 0.19
61 0.19
62 0.2
63 0.22
64 0.23
65 0.25
66 0.24
67 0.23
68 0.23
69 0.21
70 0.2
71 0.17
72 0.13
73 0.09
74 0.09
75 0.09
76 0.12
77 0.13
78 0.15
79 0.16