Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9NC50

Protein Details
Accession A0A1L9NC50   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
101-142DDGPKPPKNPQPKPQTQPKPQPKPKPQPKPLDHKPQDPPRPNBasic
NLS Segment(s)
PositionSequence
96-136PPQKRDDGPKPPKNPQPKPQTQPKPQPKPKPQPKPLDHKPQ
Subcellular Location(s) extr 21, golg 4
Family & Domain DBs
Amino Acid Sequences MKFSAVLSTLLVAGLVAAAPPAPRPTDIQPHHHPNPPPNAPLPKPHDNNKRDGPEPPKDEPTPDAPKPANDPQPHDQPKPIPQPPKDGPLPSNPNPPQKRDDGPKPPKNPQPKPQTQPKPQPKPKPQPKPLDHKPQDPPRPN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.03
4 0.03
5 0.03
6 0.04
7 0.05
8 0.07
9 0.09
10 0.1
11 0.15
12 0.2
13 0.3
14 0.34
15 0.41
16 0.47
17 0.55
18 0.58
19 0.61
20 0.59
21 0.55
22 0.6
23 0.56
24 0.51
25 0.47
26 0.5
27 0.45
28 0.5
29 0.51
30 0.51
31 0.51
32 0.58
33 0.63
34 0.59
35 0.64
36 0.63
37 0.6
38 0.53
39 0.54
40 0.52
41 0.5
42 0.53
43 0.49
44 0.47
45 0.42
46 0.42
47 0.38
48 0.39
49 0.37
50 0.32
51 0.33
52 0.28
53 0.28
54 0.32
55 0.36
56 0.36
57 0.31
58 0.36
59 0.36
60 0.45
61 0.49
62 0.45
63 0.41
64 0.37
65 0.43
66 0.46
67 0.47
68 0.45
69 0.42
70 0.49
71 0.49
72 0.52
73 0.48
74 0.41
75 0.38
76 0.39
77 0.45
78 0.39
79 0.47
80 0.46
81 0.53
82 0.54
83 0.56
84 0.51
85 0.48
86 0.51
87 0.49
88 0.55
89 0.56
90 0.64
91 0.69
92 0.72
93 0.75
94 0.77
95 0.8
96 0.79
97 0.77
98 0.78
99 0.78
100 0.79
101 0.82
102 0.84
103 0.83
104 0.86
105 0.87
106 0.88
107 0.88
108 0.92
109 0.91
110 0.92
111 0.93
112 0.94
113 0.92
114 0.92
115 0.9
116 0.9
117 0.89
118 0.89
119 0.84
120 0.81
121 0.82
122 0.82