Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9NB98

Protein Details
Accession A0A1L9NB98    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
53-74IEKNQKMKRIAREKNKKKSQGDBasic
NLS Segment(s)
PositionSequence
54-83EKNQKMKRIAREKNKKKSQGDIIGQRKGRA
Subcellular Location(s) mito 25
Family & Domain DBs
Amino Acid Sequences MVVGRPNCRSNKRQSFLVVILISAKLPGSRVRTPGDSRVGIPAKSGMKVDGGIEKNQKMKRIAREKNKKKSQGDIIGQRKGRASREAWGSLAGGMDGWRGGRSGEPAGVRETLRTVRMSSRRKTHWVTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.62
3 0.56
4 0.55
5 0.44
6 0.33
7 0.29
8 0.24
9 0.2
10 0.14
11 0.13
12 0.07
13 0.08
14 0.12
15 0.18
16 0.21
17 0.24
18 0.28
19 0.33
20 0.36
21 0.41
22 0.42
23 0.37
24 0.34
25 0.38
26 0.37
27 0.31
28 0.28
29 0.27
30 0.23
31 0.22
32 0.22
33 0.14
34 0.13
35 0.13
36 0.14
37 0.16
38 0.16
39 0.18
40 0.21
41 0.22
42 0.28
43 0.3
44 0.33
45 0.31
46 0.34
47 0.41
48 0.49
49 0.55
50 0.59
51 0.69
52 0.75
53 0.81
54 0.85
55 0.84
56 0.76
57 0.74
58 0.71
59 0.68
60 0.64
61 0.63
62 0.61
63 0.58
64 0.56
65 0.51
66 0.46
67 0.4
68 0.37
69 0.31
70 0.27
71 0.26
72 0.31
73 0.32
74 0.29
75 0.27
76 0.24
77 0.2
78 0.18
79 0.13
80 0.07
81 0.05
82 0.05
83 0.05
84 0.05
85 0.05
86 0.05
87 0.05
88 0.07
89 0.1
90 0.11
91 0.15
92 0.16
93 0.17
94 0.19
95 0.21
96 0.2
97 0.18
98 0.2
99 0.2
100 0.21
101 0.22
102 0.22
103 0.28
104 0.38
105 0.45
106 0.5
107 0.56
108 0.6
109 0.67