Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9N3J3

Protein Details
Accession A0A1L9N3J3    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
49-75MNRLVIRCKDRQIRKKKSRNLVHSFILHydrophilic
NLS Segment(s)
PositionSequence
16-40RKNSPGRRKTKRGVLVQIKKGRKKK
Subcellular Location(s) mito 22, nucl 3.5, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MVGSLLIIHFMSQIIRKNSPGRRKTKRGVLVQIKKGRKKKTSVLNTNIMNRLVIRCKDRQIRKKKSRNLVHSFILLLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.28
4 0.36
5 0.44
6 0.53
7 0.58
8 0.62
9 0.67
10 0.73
11 0.77
12 0.79
13 0.78
14 0.75
15 0.76
16 0.77
17 0.76
18 0.76
19 0.77
20 0.75
21 0.74
22 0.74
23 0.72
24 0.67
25 0.63
26 0.62
27 0.63
28 0.67
29 0.68
30 0.66
31 0.65
32 0.62
33 0.61
34 0.56
35 0.45
36 0.35
37 0.27
38 0.24
39 0.23
40 0.24
41 0.24
42 0.26
43 0.33
44 0.43
45 0.53
46 0.6
47 0.66
48 0.74
49 0.8
50 0.87
51 0.89
52 0.91
53 0.91
54 0.91
55 0.88
56 0.83
57 0.76
58 0.67