Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C0NZ94

Protein Details
Accession C0NZ94    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
20-44KKTTAAGGEKKKRSKTRKETYSSYIHydrophilic
NLS Segment(s)
PositionSequence
8-37PAGKAPEKKEAGKKTTAAGGEKKKRSKTRK
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR007125  Histone_H2A/H2B/H3  
IPR000558  Histone_H2B  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Pfam View protein in Pfam  
PF00125  Histone  
PROSITE View protein in PROSITE  
PS00357  HISTONE_H2B  
Amino Acid Sequences MASCPIRPAGKAPEKKEAGKKTTAAGGEKKKRSKTRKETYSSYIYKVLKQVHPDTGISNRAMSILNSFVNDIFERVATEASKLAAYNKKSTISSREIQTSVRLILPGELAKHAVSEGTKAVTKYSSSAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.65
3 0.7
4 0.68
5 0.63
6 0.6
7 0.57
8 0.49
9 0.5
10 0.46
11 0.41
12 0.4
13 0.45
14 0.49
15 0.56
16 0.61
17 0.65
18 0.72
19 0.77
20 0.81
21 0.81
22 0.82
23 0.84
24 0.84
25 0.8
26 0.76
27 0.76
28 0.67
29 0.58
30 0.54
31 0.45
32 0.4
33 0.4
34 0.39
35 0.32
36 0.35
37 0.35
38 0.32
39 0.33
40 0.31
41 0.28
42 0.26
43 0.25
44 0.2
45 0.18
46 0.14
47 0.13
48 0.13
49 0.11
50 0.09
51 0.08
52 0.08
53 0.08
54 0.08
55 0.07
56 0.08
57 0.08
58 0.08
59 0.06
60 0.06
61 0.06
62 0.07
63 0.07
64 0.06
65 0.07
66 0.07
67 0.07
68 0.08
69 0.07
70 0.11
71 0.16
72 0.19
73 0.22
74 0.24
75 0.26
76 0.27
77 0.29
78 0.31
79 0.31
80 0.33
81 0.33
82 0.35
83 0.33
84 0.33
85 0.33
86 0.29
87 0.25
88 0.21
89 0.18
90 0.14
91 0.14
92 0.15
93 0.14
94 0.13
95 0.12
96 0.13
97 0.12
98 0.12
99 0.11
100 0.11
101 0.1
102 0.11
103 0.11
104 0.13
105 0.16
106 0.16
107 0.18
108 0.18
109 0.19