Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9NM67

Protein Details
Accession A0A1L9NM67   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
150-169AEDAIKKHKHKDEQQQEYQSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 12, mito 6, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008816  Gly_zipper_2TM_dom  
Gene Ontology GO:0019867  C:outer membrane  
Pfam View protein in Pfam  
PF05433  Rick_17kDa_Anti  
Amino Acid Sequences MSGYDGYNNQGYYGHQQGGYNQGGYGQGGYGQQGGYPQQQGYGQQGGYDQYSQHQHQQHGGQGGASSDYYGGGGQPQYGEGQYGQQHQGGQQYGQDQRGEYNQGAPGGAQEGERGLGGAIAGGLAGGFAGHKADHGILGTIGGAIMGSIAEDAIKKHKHKDEQQQEYQSSYGGYPPQGGQSHGGGGMMDQLGGFFKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.23
4 0.24
5 0.3
6 0.3
7 0.24
8 0.19
9 0.18
10 0.17
11 0.17
12 0.15
13 0.09
14 0.08
15 0.08
16 0.09
17 0.09
18 0.08
19 0.08
20 0.09
21 0.12
22 0.13
23 0.15
24 0.14
25 0.15
26 0.16
27 0.17
28 0.2
29 0.21
30 0.18
31 0.16
32 0.17
33 0.17
34 0.17
35 0.16
36 0.12
37 0.12
38 0.18
39 0.19
40 0.25
41 0.29
42 0.29
43 0.32
44 0.35
45 0.35
46 0.32
47 0.31
48 0.24
49 0.19
50 0.18
51 0.15
52 0.12
53 0.08
54 0.05
55 0.05
56 0.05
57 0.05
58 0.04
59 0.05
60 0.05
61 0.05
62 0.05
63 0.06
64 0.06
65 0.06
66 0.07
67 0.06
68 0.08
69 0.1
70 0.13
71 0.13
72 0.14
73 0.14
74 0.14
75 0.17
76 0.15
77 0.13
78 0.12
79 0.15
80 0.16
81 0.17
82 0.17
83 0.14
84 0.14
85 0.15
86 0.16
87 0.13
88 0.12
89 0.12
90 0.11
91 0.11
92 0.1
93 0.09
94 0.08
95 0.08
96 0.06
97 0.05
98 0.05
99 0.05
100 0.05
101 0.05
102 0.04
103 0.03
104 0.03
105 0.03
106 0.03
107 0.02
108 0.02
109 0.02
110 0.02
111 0.01
112 0.01
113 0.01
114 0.02
115 0.02
116 0.03
117 0.03
118 0.03
119 0.04
120 0.04
121 0.05
122 0.05
123 0.06
124 0.05
125 0.06
126 0.05
127 0.04
128 0.04
129 0.03
130 0.03
131 0.02
132 0.02
133 0.02
134 0.02
135 0.02
136 0.02
137 0.03
138 0.03
139 0.05
140 0.12
141 0.18
142 0.21
143 0.29
144 0.37
145 0.46
146 0.55
147 0.66
148 0.7
149 0.73
150 0.8
151 0.79
152 0.73
153 0.66
154 0.57
155 0.46
156 0.36
157 0.26
158 0.2
159 0.15
160 0.15
161 0.14
162 0.15
163 0.21
164 0.21
165 0.23
166 0.22
167 0.21
168 0.22
169 0.2
170 0.19
171 0.13
172 0.11
173 0.13
174 0.1
175 0.09
176 0.07
177 0.07