Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9NCF6

Protein Details
Accession A0A1L9NCF6    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
38-63ERYARAKRNRDEAKEKRKKIERIWAEBasic
NLS Segment(s)
PositionSequence
42-59RAKRNRDEAKEKRKKIER
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013892  Cyt_c_biogenesis_Cmc1-like  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Pfam View protein in Pfam  
PF08583  Cmc1  
Amino Acid Sequences CEEIMTALDECHARGFIHKALGGCNDVKRDVNKCLAAERYARAKRNRDEAKEKRKKIERIWAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.16
3 0.16
4 0.19
5 0.2
6 0.19
7 0.2
8 0.22
9 0.21
10 0.19
11 0.19
12 0.17
13 0.17
14 0.18
15 0.2
16 0.21
17 0.22
18 0.24
19 0.23
20 0.22
21 0.23
22 0.23
23 0.23
24 0.21
25 0.21
26 0.27
27 0.31
28 0.38
29 0.42
30 0.49
31 0.52
32 0.61
33 0.66
34 0.65
35 0.7
36 0.74
37 0.79
38 0.81
39 0.82
40 0.82
41 0.83
42 0.83
43 0.81