Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9N3H5

Protein Details
Accession A0A1L9N3H5   
Localization Confidence High
Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
65-90EREGKGKGKARPPKRHAERKAGNTATBasic
NLS Segment(s)
PositionSequence
22-28RGKGRKT
66-85REGKGKGKARPPKRHAERKA
Subcellular Location(s) nucl 13, mito 9, cyto 4
Family & Domain DBs
Amino Acid Sequences MAEQEKEREREGGREGELGGVRGKGRKTRNEQVAGGGPGGRGTPKESHSLACSCCLLLLVAAGGEREGKGKGKARPPKRHAERKAGNTATA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.28
3 0.27
4 0.26
5 0.22
6 0.18
7 0.15
8 0.15
9 0.17
10 0.19
11 0.23
12 0.29
13 0.37
14 0.45
15 0.52
16 0.59
17 0.61
18 0.59
19 0.55
20 0.53
21 0.44
22 0.36
23 0.27
24 0.18
25 0.14
26 0.13
27 0.1
28 0.06
29 0.08
30 0.11
31 0.12
32 0.16
33 0.16
34 0.17
35 0.19
36 0.21
37 0.19
38 0.18
39 0.16
40 0.13
41 0.12
42 0.11
43 0.09
44 0.06
45 0.05
46 0.04
47 0.04
48 0.04
49 0.04
50 0.03
51 0.04
52 0.04
53 0.05
54 0.07
55 0.09
56 0.15
57 0.21
58 0.28
59 0.38
60 0.48
61 0.58
62 0.68
63 0.72
64 0.78
65 0.82
66 0.86
67 0.84
68 0.85
69 0.84
70 0.82
71 0.86