Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C0NY67

Protein Details
Accession C0NY67   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
9-32SSPRNNRKEYQRSHSKWREREQLSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 5, cyto 3
Family & Domain DBs
Amino Acid Sequences MAIFILRDSSPRNNRKEYQRSHSKWREREQLSPFQPAHMDLYFSVVEKRLATSIAFVWVFYRFGRAVVKLLRKYLNRSAARRRQVHRSSRVAQDSQTTETSNATAGQT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.71
3 0.76
4 0.74
5 0.74
6 0.77
7 0.76
8 0.79
9 0.82
10 0.81
11 0.8
12 0.8
13 0.8
14 0.73
15 0.75
16 0.7
17 0.7
18 0.64
19 0.62
20 0.53
21 0.44
22 0.41
23 0.33
24 0.31
25 0.2
26 0.18
27 0.11
28 0.15
29 0.14
30 0.13
31 0.13
32 0.1
33 0.11
34 0.1
35 0.1
36 0.08
37 0.08
38 0.08
39 0.08
40 0.07
41 0.1
42 0.09
43 0.08
44 0.09
45 0.09
46 0.1
47 0.09
48 0.11
49 0.08
50 0.1
51 0.11
52 0.11
53 0.14
54 0.19
55 0.27
56 0.26
57 0.3
58 0.35
59 0.35
60 0.41
61 0.45
62 0.49
63 0.49
64 0.53
65 0.6
66 0.64
67 0.71
68 0.72
69 0.69
70 0.69
71 0.72
72 0.76
73 0.74
74 0.73
75 0.69
76 0.7
77 0.72
78 0.63
79 0.55
80 0.52
81 0.47
82 0.42
83 0.39
84 0.32
85 0.26
86 0.26
87 0.24
88 0.19