Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9MV98

Protein Details
Accession A0A1L9MV98    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
7-32YTPQDVPSFKKRRNRLPNTRAKQLLRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, mito 7, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR019180  Oxidoreductase-like_N  
Pfam View protein in Pfam  
PF09791  Oxidored-like  
Amino Acid Sequences MPPSPLYTPQDVPSFKKRRNRLPNTRAKQLLRAAERDYNDPPPPPGLGECCGSSCDPCVNDLWKEELAIWRERWGDGAVEDGDKKEDEQGDESEGCAKMKMPGSWEW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.54
3 0.6
4 0.65
5 0.69
6 0.77
7 0.82
8 0.83
9 0.85
10 0.89
11 0.87
12 0.87
13 0.83
14 0.73
15 0.69
16 0.64
17 0.61
18 0.53
19 0.49
20 0.44
21 0.42
22 0.41
23 0.38
24 0.35
25 0.32
26 0.3
27 0.27
28 0.25
29 0.21
30 0.2
31 0.17
32 0.15
33 0.13
34 0.13
35 0.14
36 0.13
37 0.12
38 0.13
39 0.13
40 0.12
41 0.1
42 0.1
43 0.09
44 0.1
45 0.11
46 0.12
47 0.12
48 0.13
49 0.15
50 0.13
51 0.13
52 0.14
53 0.16
54 0.17
55 0.19
56 0.19
57 0.19
58 0.2
59 0.19
60 0.2
61 0.17
62 0.15
63 0.12
64 0.14
65 0.12
66 0.12
67 0.13
68 0.12
69 0.12
70 0.12
71 0.12
72 0.13
73 0.14
74 0.15
75 0.18
76 0.19
77 0.21
78 0.21
79 0.21
80 0.22
81 0.2
82 0.19
83 0.16
84 0.15
85 0.17
86 0.22
87 0.23