Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C0NT57

Protein Details
Accession C0NT57    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
105-131WWLVKVSQQRRTKGRRRRCKPRGRVGAHydrophilic
NLS Segment(s)
PositionSequence
114-131RRTKGRRRRCKPRGRVGA
Subcellular Location(s) mito 18, nucl 5, cyto 1, plas 1, extr 1, pero 1, cyto_pero 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAQHKGGPASAVIKQTNICLIQPLNLSPPAAASPTTDKKRFKSCWILSRNQNEKYPICLRCEVPNTAHSRDGSHTFESKRQYLGHLSCRNVAIVGCALSSYFSIWWLVKVSQQRRTKGRRRRCKPRGRVGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.26
4 0.23
5 0.2
6 0.18
7 0.17
8 0.19
9 0.2
10 0.2
11 0.19
12 0.19
13 0.19
14 0.15
15 0.16
16 0.14
17 0.13
18 0.12
19 0.11
20 0.17
21 0.26
22 0.32
23 0.38
24 0.41
25 0.44
26 0.53
27 0.54
28 0.54
29 0.57
30 0.57
31 0.6
32 0.63
33 0.65
34 0.63
35 0.7
36 0.7
37 0.63
38 0.59
39 0.54
40 0.48
41 0.48
42 0.47
43 0.39
44 0.35
45 0.34
46 0.32
47 0.33
48 0.36
49 0.31
50 0.26
51 0.29
52 0.3
53 0.29
54 0.3
55 0.25
56 0.23
57 0.23
58 0.25
59 0.23
60 0.21
61 0.23
62 0.22
63 0.26
64 0.28
65 0.28
66 0.26
67 0.24
68 0.24
69 0.27
70 0.3
71 0.35
72 0.36
73 0.37
74 0.37
75 0.37
76 0.34
77 0.28
78 0.24
79 0.15
80 0.11
81 0.1
82 0.07
83 0.07
84 0.07
85 0.07
86 0.07
87 0.07
88 0.06
89 0.06
90 0.08
91 0.09
92 0.1
93 0.12
94 0.13
95 0.17
96 0.26
97 0.32
98 0.4
99 0.47
100 0.53
101 0.6
102 0.7
103 0.76
104 0.78
105 0.82
106 0.84
107 0.88
108 0.92
109 0.93
110 0.94
111 0.94