Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9NB61

Protein Details
Accession A0A1L9NB61    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
33-69SAEEKEKKKEKGKDSKHKKERKKRKKKTLTGRHGTSLBasic
NLS Segment(s)
PositionSequence
37-64KEKKKEKGKDSKHKKERKKRKKKTLTGR
78-101KLSIEKKSPSSVRTVIGKKRKKKK
Subcellular Location(s) mito 13.5, mito_nucl 13.166, nucl 11.5, cyto_nucl 7.833
Family & Domain DBs
Amino Acid Sequences MYLSRPSVRPSARASPSSISLSLSIYQSRISSSAEEKEKKKEKGKDSKHKKERKKRKKKTLTGRHGTSLSGESSTQKKLSIEKKSPSSVRTVIGKKRKKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.43
3 0.44
4 0.43
5 0.36
6 0.28
7 0.23
8 0.23
9 0.2
10 0.19
11 0.16
12 0.13
13 0.14
14 0.12
15 0.13
16 0.12
17 0.12
18 0.12
19 0.14
20 0.2
21 0.26
22 0.31
23 0.32
24 0.41
25 0.47
26 0.52
27 0.58
28 0.6
29 0.63
30 0.68
31 0.77
32 0.79
33 0.82
34 0.86
35 0.88
36 0.89
37 0.9
38 0.9
39 0.91
40 0.91
41 0.92
42 0.92
43 0.93
44 0.95
45 0.94
46 0.95
47 0.94
48 0.93
49 0.91
50 0.83
51 0.75
52 0.65
53 0.55
54 0.45
55 0.35
56 0.25
57 0.18
58 0.15
59 0.14
60 0.16
61 0.18
62 0.17
63 0.17
64 0.18
65 0.25
66 0.33
67 0.4
68 0.45
69 0.5
70 0.55
71 0.62
72 0.64
73 0.58
74 0.56
75 0.49
76 0.46
77 0.47
78 0.49
79 0.51
80 0.58
81 0.66