Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9N2S8

Protein Details
Accession A0A1L9N2S8    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
44-78AKAPWKESRDGNKRRNNRKRQQWRKKPLPLPTHRSBasic
NLS Segment(s)
PositionSequence
49-71KESRDGNKRRNNRKRQQWRKKPL
Subcellular Location(s) mito_nucl 10.166, nucl 10, mito 10, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MLLPGHWHTTDTRSGGRHFGLCAGPPVADQQYPLNCLSTEPDEAKAPWKESRDGNKRRNNRKRQQWRKKPLPLPTHRSPLAGVWAGLGSVVPDPNIKLGSVVSRVETFGPSSFFHGDPSARKTCCS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.33
3 0.33
4 0.3
5 0.26
6 0.26
7 0.23
8 0.21
9 0.22
10 0.19
11 0.16
12 0.15
13 0.18
14 0.16
15 0.14
16 0.15
17 0.17
18 0.18
19 0.2
20 0.21
21 0.19
22 0.17
23 0.17
24 0.19
25 0.17
26 0.17
27 0.16
28 0.17
29 0.17
30 0.17
31 0.23
32 0.22
33 0.22
34 0.23
35 0.25
36 0.26
37 0.31
38 0.41
39 0.46
40 0.53
41 0.6
42 0.65
43 0.72
44 0.81
45 0.85
46 0.86
47 0.85
48 0.86
49 0.88
50 0.91
51 0.93
52 0.92
53 0.92
54 0.92
55 0.92
56 0.87
57 0.85
58 0.84
59 0.81
60 0.78
61 0.73
62 0.69
63 0.6
64 0.54
65 0.46
66 0.36
67 0.32
68 0.24
69 0.18
70 0.12
71 0.11
72 0.1
73 0.09
74 0.08
75 0.04
76 0.05
77 0.05
78 0.05
79 0.05
80 0.06
81 0.08
82 0.09
83 0.08
84 0.08
85 0.09
86 0.11
87 0.14
88 0.14
89 0.14
90 0.15
91 0.16
92 0.16
93 0.16
94 0.15
95 0.14
96 0.16
97 0.15
98 0.19
99 0.21
100 0.2
101 0.21
102 0.22
103 0.24
104 0.27
105 0.33
106 0.37