Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9NE53

Protein Details
Accession A0A1L9NE53   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MASKKRNIRRRRSSSKRSTYQQRTRRKNSLFHydrophilic
NLS Segment(s)
PositionSequence
4-18KKRNIRRRRSSSKRS
Subcellular Location(s) nucl 14.5, mito_nucl 12.999, cyto_nucl 10.666, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0006351  P:DNA-templated transcription  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
PROSITE View protein in PROSITE  
PS50066  MADS_BOX_2  
Amino Acid Sequences MASKKRNIRRRRSSSKRSTYQQRTRRKNSLFLKAFEYCNFCDADITLVIRLKHNSQVFKFNSNSQWHPSREELDTWYPKLREIAWNKLAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.93
3 0.9
4 0.88
5 0.88
6 0.88
7 0.88
8 0.86
9 0.86
10 0.86
11 0.86
12 0.87
13 0.79
14 0.78
15 0.75
16 0.76
17 0.69
18 0.61
19 0.58
20 0.51
21 0.48
22 0.4
23 0.37
24 0.26
25 0.23
26 0.21
27 0.16
28 0.13
29 0.11
30 0.11
31 0.08
32 0.08
33 0.07
34 0.09
35 0.09
36 0.11
37 0.12
38 0.12
39 0.18
40 0.21
41 0.25
42 0.25
43 0.34
44 0.34
45 0.38
46 0.39
47 0.36
48 0.39
49 0.4
50 0.41
51 0.38
52 0.43
53 0.4
54 0.42
55 0.41
56 0.37
57 0.35
58 0.34
59 0.33
60 0.35
61 0.38
62 0.37
63 0.4
64 0.37
65 0.36
66 0.37
67 0.34
68 0.35
69 0.37
70 0.44