Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9N1M7

Protein Details
Accession A0A1L9N1M7    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
40-69KMPQFDRDYRHKHKGNPPNKQKPREIPGLFBasic
NLS Segment(s)
PositionSequence
53-60KGNPPNKQ
Subcellular Location(s) cyto_nucl 10.5, cyto 10, nucl 9, pero 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR019268  DUF2278  
IPR036415  Lamin_tail_dom_sf  
Pfam View protein in Pfam  
PF10042  DUF2278  
Amino Acid Sequences MPVKDYGIWKGFPAHYELEDRFEDPKSPHLSLYYHDNNAKMPQFDRDYRHKHKGNPPNKQKPREIPGLFRAAINIKSTGKESRLAYWVNHNIVEHPIAEKLSNLDFGFHPIEDLTDFDGKGLDFIRGNLFTTQSGRVLPHDIPGTNNDIIDVLEPEVKKAIHHKATIYLFGSMFNTRNGIHNVHMNQGNIPHFVKDDGVFQDGGLLIEYDDHWTGVFLAFASQAAHTDDHNGHAFAKHVVTWSDILPKEIIENSVTIKEALINPRGRDDRSAKEKEFVTLENLTNHRVALESWRFHNAAGQVQALPHNAALDSRAMKRFEMSNCPLSNNGDTITLLNEEGLRVDGVSYGARQGATEGRPIVFAH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.27
3 0.32
4 0.32
5 0.3
6 0.3
7 0.3
8 0.28
9 0.27
10 0.28
11 0.24
12 0.31
13 0.32
14 0.32
15 0.32
16 0.33
17 0.32
18 0.3
19 0.39
20 0.37
21 0.36
22 0.37
23 0.36
24 0.35
25 0.41
26 0.42
27 0.35
28 0.3
29 0.32
30 0.36
31 0.41
32 0.46
33 0.49
34 0.56
35 0.62
36 0.71
37 0.69
38 0.72
39 0.77
40 0.81
41 0.81
42 0.83
43 0.85
44 0.86
45 0.9
46 0.88
47 0.87
48 0.85
49 0.82
50 0.82
51 0.74
52 0.69
53 0.65
54 0.65
55 0.56
56 0.47
57 0.42
58 0.34
59 0.33
60 0.28
61 0.25
62 0.19
63 0.2
64 0.23
65 0.24
66 0.23
67 0.26
68 0.26
69 0.27
70 0.3
71 0.3
72 0.29
73 0.34
74 0.38
75 0.34
76 0.34
77 0.3
78 0.27
79 0.27
80 0.27
81 0.18
82 0.14
83 0.13
84 0.12
85 0.12
86 0.11
87 0.11
88 0.11
89 0.14
90 0.12
91 0.13
92 0.13
93 0.16
94 0.17
95 0.15
96 0.14
97 0.11
98 0.12
99 0.1
100 0.11
101 0.1
102 0.1
103 0.1
104 0.09
105 0.1
106 0.09
107 0.1
108 0.1
109 0.09
110 0.07
111 0.08
112 0.12
113 0.11
114 0.13
115 0.13
116 0.13
117 0.13
118 0.15
119 0.15
120 0.13
121 0.14
122 0.13
123 0.13
124 0.15
125 0.15
126 0.16
127 0.16
128 0.16
129 0.16
130 0.17
131 0.2
132 0.17
133 0.17
134 0.14
135 0.12
136 0.12
137 0.11
138 0.1
139 0.06
140 0.09
141 0.09
142 0.09
143 0.1
144 0.1
145 0.1
146 0.15
147 0.22
148 0.23
149 0.24
150 0.25
151 0.3
152 0.31
153 0.32
154 0.28
155 0.22
156 0.17
157 0.16
158 0.17
159 0.12
160 0.12
161 0.1
162 0.11
163 0.1
164 0.12
165 0.14
166 0.14
167 0.14
168 0.17
169 0.18
170 0.2
171 0.22
172 0.19
173 0.17
174 0.19
175 0.19
176 0.17
177 0.16
178 0.13
179 0.11
180 0.11
181 0.12
182 0.09
183 0.11
184 0.1
185 0.11
186 0.11
187 0.1
188 0.11
189 0.1
190 0.1
191 0.07
192 0.06
193 0.04
194 0.05
195 0.05
196 0.06
197 0.05
198 0.05
199 0.05
200 0.05
201 0.06
202 0.06
203 0.05
204 0.04
205 0.04
206 0.04
207 0.05
208 0.05
209 0.05
210 0.06
211 0.07
212 0.08
213 0.07
214 0.11
215 0.11
216 0.13
217 0.14
218 0.14
219 0.13
220 0.13
221 0.14
222 0.11
223 0.12
224 0.09
225 0.1
226 0.1
227 0.11
228 0.11
229 0.12
230 0.17
231 0.17
232 0.18
233 0.17
234 0.16
235 0.16
236 0.15
237 0.16
238 0.09
239 0.1
240 0.1
241 0.11
242 0.12
243 0.1
244 0.1
245 0.11
246 0.14
247 0.17
248 0.22
249 0.25
250 0.25
251 0.32
252 0.34
253 0.33
254 0.36
255 0.38
256 0.4
257 0.46
258 0.52
259 0.47
260 0.49
261 0.49
262 0.45
263 0.42
264 0.34
265 0.29
266 0.26
267 0.27
268 0.27
269 0.28
270 0.27
271 0.25
272 0.24
273 0.19
274 0.16
275 0.14
276 0.18
277 0.24
278 0.25
279 0.27
280 0.31
281 0.31
282 0.31
283 0.34
284 0.27
285 0.25
286 0.25
287 0.24
288 0.2
289 0.21
290 0.23
291 0.2
292 0.19
293 0.14
294 0.12
295 0.11
296 0.11
297 0.11
298 0.13
299 0.15
300 0.19
301 0.24
302 0.25
303 0.25
304 0.28
305 0.33
306 0.33
307 0.39
308 0.4
309 0.43
310 0.43
311 0.45
312 0.44
313 0.42
314 0.4
315 0.32
316 0.27
317 0.2
318 0.19
319 0.18
320 0.18
321 0.15
322 0.12
323 0.12
324 0.11
325 0.1
326 0.1
327 0.1
328 0.08
329 0.07
330 0.08
331 0.08
332 0.09
333 0.1
334 0.1
335 0.1
336 0.12
337 0.12
338 0.11
339 0.13
340 0.18
341 0.19
342 0.23
343 0.24
344 0.23