Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9N970

Protein Details
Accession A0A1L9N970    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
88-107GYNPRVCREQRRAMLRNKVEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, extr 9, plas 3, E.R. 2
Family & Domain DBs
Amino Acid Sequences MSPKPMVTNRIHSVLNPGSVGRSVGRPAGWPCQFLSVAVSVSVCLFLVSTSREGRHASLGYWQAIIRLDKKTYVSFWGSLPSRAANSGYNPRVCREQRRAMLRNKVENGGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.34
3 0.26
4 0.22
5 0.19
6 0.19
7 0.2
8 0.14
9 0.13
10 0.13
11 0.14
12 0.14
13 0.16
14 0.19
15 0.27
16 0.27
17 0.26
18 0.25
19 0.27
20 0.27
21 0.23
22 0.22
23 0.14
24 0.13
25 0.12
26 0.11
27 0.07
28 0.07
29 0.07
30 0.05
31 0.04
32 0.04
33 0.03
34 0.05
35 0.06
36 0.08
37 0.09
38 0.1
39 0.12
40 0.13
41 0.13
42 0.15
43 0.14
44 0.12
45 0.15
46 0.17
47 0.16
48 0.15
49 0.14
50 0.13
51 0.14
52 0.16
53 0.14
54 0.14
55 0.15
56 0.16
57 0.18
58 0.19
59 0.18
60 0.21
61 0.21
62 0.19
63 0.19
64 0.24
65 0.23
66 0.23
67 0.23
68 0.2
69 0.18
70 0.19
71 0.2
72 0.15
73 0.19
74 0.27
75 0.31
76 0.35
77 0.36
78 0.37
79 0.45
80 0.48
81 0.52
82 0.52
83 0.57
84 0.6
85 0.69
86 0.75
87 0.74
88 0.8
89 0.78
90 0.79
91 0.73