Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9MZV1

Protein Details
Accession A0A1L9MZV1    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-28AGGETRRKKKVRKKEKREPLANRKWILRBasic
NLS Segment(s)
PositionSequence
6-23RRKKKVRKKEKREPLANR
Subcellular Location(s) nucl 14, mito 4, plas 3, E.R. 3, cyto 1, golg 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences AGGETRRKKKVRKKEKREPLANRKWILRTTDINPLNSLTLTLSLSSLSLSSSLSFFPFPGPISHFFFSLFIRFVVFFFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.94
3 0.95
4 0.94
5 0.94
6 0.93
7 0.92
8 0.89
9 0.81
10 0.74
11 0.67
12 0.6
13 0.53
14 0.46
15 0.4
16 0.35
17 0.41
18 0.39
19 0.36
20 0.33
21 0.3
22 0.26
23 0.21
24 0.18
25 0.09
26 0.07
27 0.07
28 0.06
29 0.06
30 0.05
31 0.05
32 0.05
33 0.05
34 0.04
35 0.04
36 0.05
37 0.05
38 0.05
39 0.06
40 0.07
41 0.07
42 0.07
43 0.08
44 0.09
45 0.1
46 0.12
47 0.15
48 0.18
49 0.24
50 0.25
51 0.24
52 0.24
53 0.24
54 0.24
55 0.23
56 0.2
57 0.14
58 0.15
59 0.15