Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9NMD3

Protein Details
Accession A0A1L9NMD3    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
71-96EEDGGRREKKGKKSDRRNGDGRKSRLBasic
NLS Segment(s)
PositionSequence
75-94GRREKKGKKSDRRNGDGRKS
Subcellular Location(s) cyto_nucl 11, nucl 10.5, cyto 10.5, mito 4
Family & Domain DBs
Amino Acid Sequences MTKEMRSSSGPWGVKGAPLDGVGKKGDGRGKNKVFRGTDSFEGCRLTVKVRQKRTGQAVVDVELEGAVEGEEDGGRREKKGKKSDRRNGDGRKSRLVMTEQPYRLLVQAIGAGKAPSIGDEGRGAASAQPVWAMNG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.3
3 0.25
4 0.17
5 0.17
6 0.2
7 0.17
8 0.19
9 0.16
10 0.16
11 0.16
12 0.19
13 0.24
14 0.28
15 0.33
16 0.41
17 0.49
18 0.55
19 0.59
20 0.62
21 0.57
22 0.55
23 0.56
24 0.5
25 0.46
26 0.44
27 0.4
28 0.34
29 0.33
30 0.28
31 0.24
32 0.2
33 0.18
34 0.2
35 0.29
36 0.36
37 0.42
38 0.49
39 0.51
40 0.56
41 0.6
42 0.61
43 0.51
44 0.47
45 0.41
46 0.36
47 0.32
48 0.25
49 0.18
50 0.11
51 0.1
52 0.05
53 0.04
54 0.03
55 0.02
56 0.02
57 0.02
58 0.02
59 0.03
60 0.04
61 0.08
62 0.08
63 0.09
64 0.17
65 0.24
66 0.33
67 0.43
68 0.53
69 0.61
70 0.72
71 0.8
72 0.83
73 0.83
74 0.83
75 0.82
76 0.82
77 0.8
78 0.73
79 0.7
80 0.62
81 0.56
82 0.5
83 0.45
84 0.42
85 0.38
86 0.43
87 0.37
88 0.37
89 0.37
90 0.34
91 0.3
92 0.24
93 0.18
94 0.1
95 0.13
96 0.13
97 0.12
98 0.12
99 0.12
100 0.11
101 0.11
102 0.1
103 0.07
104 0.09
105 0.09
106 0.1
107 0.11
108 0.12
109 0.12
110 0.12
111 0.12
112 0.11
113 0.12
114 0.11
115 0.11
116 0.11