Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9NPD1

Protein Details
Accession A0A1L9NPD1   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
32-73GGRQNKKEKMRVPKRGQKRKIAKEEKCSRRRRSPEGKAIKKHBasic
NLS Segment(s)
PositionSequence
10-10K
30-73RGGGRQNKKEKMRVPKRGQKRKIAKEEKCSRRRRSPEGKAIKKH
Subcellular Location(s) mito 13, nucl 9, cyto 4
Family & Domain DBs
Amino Acid Sequences MDRGEKSERKKKEGRLFDDHLFSVQQNPGRGGGRQNKKEKMRVPKRGQKRKIAKEEKCSRRRRSPEGKAIKKHPIWMQVPPGPWTGNFALRGISREKFVLGGTHLIGQGLPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.76
3 0.75
4 0.71
5 0.67
6 0.57
7 0.47
8 0.38
9 0.31
10 0.26
11 0.23
12 0.23
13 0.2
14 0.21
15 0.23
16 0.23
17 0.24
18 0.28
19 0.34
20 0.4
21 0.48
22 0.54
23 0.6
24 0.64
25 0.7
26 0.69
27 0.71
28 0.72
29 0.74
30 0.76
31 0.77
32 0.82
33 0.86
34 0.85
35 0.84
36 0.84
37 0.83
38 0.84
39 0.85
40 0.8
41 0.8
42 0.84
43 0.84
44 0.83
45 0.82
46 0.78
47 0.78
48 0.79
49 0.78
50 0.78
51 0.77
52 0.78
53 0.8
54 0.81
55 0.77
56 0.76
57 0.75
58 0.66
59 0.62
60 0.56
61 0.53
62 0.47
63 0.45
64 0.46
65 0.41
66 0.42
67 0.38
68 0.36
69 0.28
70 0.26
71 0.26
72 0.21
73 0.22
74 0.21
75 0.19
76 0.2
77 0.2
78 0.23
79 0.22
80 0.21
81 0.19
82 0.19
83 0.19
84 0.17
85 0.17
86 0.17
87 0.15
88 0.17
89 0.16
90 0.18
91 0.17
92 0.16