Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9NGR6

Protein Details
Accession A0A1L9NGR6    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
410-440DAPGDDSSPRKKSKKKRGGRKKSGNSSTPWSHydrophilic
NLS Segment(s)
PositionSequence
418-432PRKKSKKKRGGRKKS
Subcellular Location(s) nucl 14, cyto 12
Family & Domain DBs
Amino Acid Sequences MAKIFPADSPLCNLFGTAPKNPTQNVFSEPESPPKMITDYPQPRDSPYASPINYISIGRTTYAIPEYYVLKIPNLKFAYMKEFALEEMYADIGHTFIHYLYTGEYQTLAASPNVPPSKTRAREFKRSVYAFHMAQRHQIQGLLDHAQRYMHTFVDSVSTLELLKIAREVYATMFTGKKWFEDFVYDQLAAAFKAGEEQFRNDILKCGVGSDAKFDQFLLDLVLKIYSGSIAELTKATTNGPAASRAAFVSDEDASTDQTTLVSDSNDTKSDPEASVDGSDDGVKDSKPADAVPELPEEKPKSPTPAPASPLSFTFRSPQPVRYQSFAPEPTPSKTEPKSEPEPTLKEDLKPATSSKPVPEKAAPVHPEEAPQPEKAIQPDEDIQPEKASSDKPDPNPKFTPRSGAQTPEDAPGDDSSPRKKSKKKRGGRKKSGNSSTPWSGNPNAPLSGNSNTSWNPVAGTPDKLGPKWKAESISFFSNHER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.25
3 0.29
4 0.29
5 0.31
6 0.34
7 0.38
8 0.39
9 0.41
10 0.38
11 0.36
12 0.35
13 0.35
14 0.33
15 0.36
16 0.37
17 0.41
18 0.41
19 0.39
20 0.34
21 0.32
22 0.33
23 0.28
24 0.3
25 0.32
26 0.39
27 0.44
28 0.48
29 0.47
30 0.47
31 0.51
32 0.5
33 0.44
34 0.39
35 0.42
36 0.37
37 0.39
38 0.36
39 0.34
40 0.33
41 0.28
42 0.24
43 0.18
44 0.19
45 0.17
46 0.17
47 0.14
48 0.16
49 0.18
50 0.17
51 0.15
52 0.15
53 0.17
54 0.18
55 0.21
56 0.18
57 0.19
58 0.25
59 0.25
60 0.33
61 0.33
62 0.32
63 0.3
64 0.32
65 0.36
66 0.31
67 0.31
68 0.23
69 0.21
70 0.2
71 0.21
72 0.18
73 0.11
74 0.09
75 0.09
76 0.08
77 0.07
78 0.07
79 0.05
80 0.05
81 0.05
82 0.05
83 0.04
84 0.06
85 0.06
86 0.06
87 0.08
88 0.1
89 0.11
90 0.1
91 0.11
92 0.1
93 0.1
94 0.1
95 0.1
96 0.08
97 0.09
98 0.1
99 0.18
100 0.2
101 0.2
102 0.2
103 0.26
104 0.36
105 0.4
106 0.45
107 0.47
108 0.52
109 0.63
110 0.68
111 0.7
112 0.69
113 0.65
114 0.62
115 0.57
116 0.54
117 0.45
118 0.44
119 0.42
120 0.33
121 0.38
122 0.38
123 0.34
124 0.29
125 0.29
126 0.24
127 0.2
128 0.22
129 0.2
130 0.18
131 0.17
132 0.17
133 0.16
134 0.16
135 0.18
136 0.16
137 0.13
138 0.12
139 0.12
140 0.12
141 0.14
142 0.14
143 0.11
144 0.1
145 0.09
146 0.09
147 0.08
148 0.09
149 0.06
150 0.06
151 0.07
152 0.07
153 0.06
154 0.07
155 0.07
156 0.07
157 0.1
158 0.1
159 0.11
160 0.11
161 0.11
162 0.15
163 0.15
164 0.15
165 0.14
166 0.15
167 0.13
168 0.18
169 0.19
170 0.18
171 0.21
172 0.2
173 0.18
174 0.17
175 0.17
176 0.12
177 0.1
178 0.07
179 0.04
180 0.07
181 0.08
182 0.1
183 0.11
184 0.13
185 0.14
186 0.16
187 0.18
188 0.14
189 0.16
190 0.14
191 0.14
192 0.11
193 0.11
194 0.1
195 0.1
196 0.1
197 0.12
198 0.13
199 0.12
200 0.13
201 0.12
202 0.11
203 0.1
204 0.1
205 0.07
206 0.06
207 0.06
208 0.06
209 0.06
210 0.06
211 0.05
212 0.05
213 0.04
214 0.03
215 0.03
216 0.04
217 0.04
218 0.05
219 0.05
220 0.06
221 0.06
222 0.07
223 0.07
224 0.07
225 0.07
226 0.08
227 0.08
228 0.09
229 0.09
230 0.09
231 0.09
232 0.08
233 0.09
234 0.08
235 0.07
236 0.08
237 0.08
238 0.07
239 0.07
240 0.08
241 0.07
242 0.08
243 0.08
244 0.06
245 0.05
246 0.06
247 0.06
248 0.06
249 0.06
250 0.06
251 0.09
252 0.1
253 0.11
254 0.11
255 0.11
256 0.11
257 0.13
258 0.13
259 0.11
260 0.1
261 0.1
262 0.1
263 0.1
264 0.09
265 0.07
266 0.07
267 0.06
268 0.07
269 0.07
270 0.06
271 0.07
272 0.07
273 0.07
274 0.08
275 0.08
276 0.09
277 0.1
278 0.11
279 0.12
280 0.16
281 0.16
282 0.16
283 0.21
284 0.22
285 0.23
286 0.26
287 0.25
288 0.28
289 0.28
290 0.35
291 0.37
292 0.39
293 0.4
294 0.4
295 0.41
296 0.35
297 0.35
298 0.32
299 0.26
300 0.22
301 0.22
302 0.21
303 0.27
304 0.28
305 0.31
306 0.35
307 0.42
308 0.44
309 0.42
310 0.42
311 0.37
312 0.41
313 0.39
314 0.32
315 0.29
316 0.3
317 0.3
318 0.31
319 0.31
320 0.31
321 0.31
322 0.36
323 0.36
324 0.4
325 0.45
326 0.45
327 0.49
328 0.48
329 0.49
330 0.46
331 0.49
332 0.43
333 0.37
334 0.38
335 0.35
336 0.31
337 0.3
338 0.28
339 0.26
340 0.29
341 0.3
342 0.31
343 0.37
344 0.37
345 0.4
346 0.4
347 0.4
348 0.4
349 0.46
350 0.42
351 0.37
352 0.38
353 0.33
354 0.33
355 0.3
356 0.32
357 0.26
358 0.24
359 0.23
360 0.23
361 0.25
362 0.25
363 0.27
364 0.21
365 0.23
366 0.26
367 0.27
368 0.29
369 0.29
370 0.27
371 0.24
372 0.24
373 0.2
374 0.19
375 0.18
376 0.19
377 0.25
378 0.32
379 0.38
380 0.5
381 0.53
382 0.58
383 0.63
384 0.65
385 0.63
386 0.57
387 0.58
388 0.5
389 0.55
390 0.51
391 0.5
392 0.46
393 0.44
394 0.44
395 0.4
396 0.37
397 0.3
398 0.28
399 0.23
400 0.22
401 0.21
402 0.23
403 0.26
404 0.33
405 0.4
406 0.48
407 0.56
408 0.65
409 0.73
410 0.8
411 0.84
412 0.88
413 0.91
414 0.94
415 0.96
416 0.96
417 0.95
418 0.95
419 0.94
420 0.88
421 0.81
422 0.77
423 0.73
424 0.65
425 0.56
426 0.5
427 0.44
428 0.44
429 0.43
430 0.38
431 0.33
432 0.3
433 0.3
434 0.3
435 0.3
436 0.28
437 0.24
438 0.25
439 0.24
440 0.27
441 0.26
442 0.22
443 0.2
444 0.18
445 0.24
446 0.23
447 0.26
448 0.25
449 0.29
450 0.33
451 0.33
452 0.4
453 0.38
454 0.42
455 0.44
456 0.47
457 0.47
458 0.46
459 0.52
460 0.5
461 0.53
462 0.47