Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9NB73

Protein Details
Accession A0A1L9NB73   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
23-61QINKGNPVEKGKRRRRPAHWRDHQCKKRTHPGCRSSRTKBasic
NLS Segment(s)
PositionSequence
31-43EKGKRRRRPAHWR
Subcellular Location(s) mito 16.5, mito_nucl 11.5, nucl 5.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MTARSGWNVRRKEMGVCLSSGTQINKGNPVEKGKRRRRPAHWRDHQCKKRTHPGCRSSRTKTRCENGTRRREGRQSGAMVITFIEIGRIYELKARWGHVQKPRQALGLDDSFEWVSGRRRCTHTRTAGWPAPVQRTWCVTSDCMIRCSSISSHP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.4
3 0.37
4 0.36
5 0.3
6 0.31
7 0.29
8 0.23
9 0.22
10 0.24
11 0.25
12 0.29
13 0.3
14 0.31
15 0.32
16 0.39
17 0.44
18 0.49
19 0.58
20 0.63
21 0.71
22 0.78
23 0.84
24 0.86
25 0.88
26 0.89
27 0.89
28 0.9
29 0.91
30 0.9
31 0.91
32 0.89
33 0.85
34 0.83
35 0.79
36 0.79
37 0.77
38 0.78
39 0.77
40 0.78
41 0.8
42 0.8
43 0.8
44 0.77
45 0.77
46 0.72
47 0.69
48 0.67
49 0.63
50 0.63
51 0.64
52 0.67
53 0.68
54 0.72
55 0.72
56 0.68
57 0.67
58 0.64
59 0.59
60 0.53
61 0.48
62 0.39
63 0.32
64 0.3
65 0.24
66 0.2
67 0.16
68 0.12
69 0.07
70 0.05
71 0.04
72 0.04
73 0.04
74 0.05
75 0.05
76 0.05
77 0.09
78 0.09
79 0.14
80 0.15
81 0.17
82 0.23
83 0.27
84 0.34
85 0.39
86 0.47
87 0.48
88 0.53
89 0.52
90 0.48
91 0.44
92 0.38
93 0.34
94 0.29
95 0.24
96 0.18
97 0.18
98 0.15
99 0.15
100 0.14
101 0.11
102 0.17
103 0.2
104 0.24
105 0.28
106 0.34
107 0.41
108 0.48
109 0.55
110 0.56
111 0.58
112 0.61
113 0.65
114 0.63
115 0.6
116 0.57
117 0.51
118 0.49
119 0.46
120 0.42
121 0.37
122 0.37
123 0.36
124 0.36
125 0.35
126 0.29
127 0.3
128 0.35
129 0.34
130 0.32
131 0.3
132 0.28
133 0.25
134 0.28